Tested Applications
| Positive WB detected in | mouse colon tissue, mouse lung tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 12 publications below |
| IHC | See 1 publications below |
| ChIP | See 2 publications below |
Product Information
21159-1-AP targets TEAD2 in WB, IHC, ChIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14074 Product name: Recombinant human TEAD2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 121-251 aa of BC051301 Sequence: DQVSKDKAFQTMATMSSAQLISAPSLQAKLGPTGPQVVQASELFQFWSGGSGPPWNVPDVKPFSQTPFTLSLTPPSTDLPGYEPPQALSPLPPPTPSPPAWQARGLGTARLQLVEFSAFVEPPDAVDSYQR Predict reactive species |
| Full Name | TEA domain family member 2 |
| Calculated Molecular Weight | 447 aa, 49 kDa |
| Observed Molecular Weight | 55-65 kDa |
| GenBank Accession Number | BC051301 |
| Gene Symbol | TEAD2 |
| Gene ID (NCBI) | 8463 |
| RRID | AB_2861186 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q15562 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TEAD2 belongs to a protein family that share the TEA/ATTS domain. It acts as a transcriptional factor by cooperatively binding to the GT-IIC and Sph(I 1 II) enhansons in the simian virus 40 (SV40) enhancer. Also it can modulate SV40 late transcription together with large T antigen. The transcriptional activity of TEAD2 required several regions of the proteins , a TBP-associated factors and a limiting transcriptional intermediary factors. TEAD2 also preforms an essential role in the Hippo signaling pathway. TEAD2 regulates gene expression of YAP1 and WWTR1/TAZ, thus mediating cell proliferation, migration and epithelial mesenchymal transition induction. TEAD2 is strongly expressed in human ovarian carcinoma cell line.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TEAD2 antibody 21159-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
ACS Nano Hepatic Stellate Cell- and Liver Microbiome-Specific Delivery System for Dihydrotanshinone I to Ameliorate Liver Fibrosis | ||
Aging (Albany NY) Integrative bioinformatics and experimental analysis revealed TEAD as novel prognostic target for hepatocellular carcinoma and its roles in ferroptosis regulation.
| ||
Oncol Rep 17‑AAG synergizes with Belinostat to exhibit a negative effect on the proliferation and invasion of MDA‑MB‑231 breast cancer cells. | ||
Int J Gen Med Significance of TEAD Family in Diagnosis, Prognosis and Immune Response for Ovarian Serous Carcinoma.
| ||
Cell Rep YTHDF2/3 Are Required for Somatic Reprogramming through Different RNA Deadenylation Pathways. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Mounika (Verified Customer) (03-23-2026) | Very good antibody, used for our western blots mostly, happy for it!
|
FH Soumya (Verified Customer) (10-29-2025) | Had a good experience using for the first for my experiment
|



