Anti-Human TEM1/CD248 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of human peripheral blood lymphocytes using 98709-3-RR (same clone as 98709-3-PBS)

  1x10^6 human peripheral blood lymphocytes were surface stained with 0.25 ug Anti-Human TEM1/CD248 Rabbit RecAb (98709-3-RR, Clone: 251338B12) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 647 Anti-Human CD8a. Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98709-3-PBS in a different storage buffer formulation.

• 

  FC experiment of human peripheral blood lymphocytes using 98709-3-RR (same clone as 98709-3-PBS)

  1x10^6 human peripheral blood lymphocytes were surface stained with 0.25 ug Anti-Human TEM1/CD248 Rabbit RecAb (98709-3-RR, Clone: 251338B12) (red) or 0.25 ug Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98709-3-PBS in a different storage buffer formulation.

• 

  Affinity of 98709-3-RR

  Biolayer interferometry (BLl) kinetic assays of 98709-3-RR against Human TEM1/CD248 were performed. The affinity constant is 0.423 nM.

TEM1/CD248 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98709-3-PBS

Clone No.251338B12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

CD248, TEM1, CD164L1, CD248 molecule, endosialin, Endosialin

---

Product Information

98709-3-PBS targets TEM1/CD248 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4427

  Product name: recombinant human CD248 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 18-360 aa of BC051340

  Sequence: QDPWAAEPRAACGPSSCYALFPRRRTFLEAWRACRELGGDLATPRTPEEAQRVDSLVGAGPASRLLWIGLQRQARQCQLQRPLRGFTWTTGDQDTAFTNWAQPASGGPCPAQRCVALEASGEHRWLEGSCTLAVDGYLCQFGFEGACPALQDEAGQAGPAVYTTPFHLVSTEFEWLPFGSVAAVQCQAGRGASLLCVKQPEGGVGWSRAGPLCLGTGCSPDNGGCEHECVEEVDGHVSCRCTEGFRLAADGRSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGFRPAEDDPHRCVDTDECQIAGVCQQMCVNYVGGFECYCSEGHELEADGISCSPAGAMGAQA

• Full Name: CD248 molecule, endosialin
• Calculated Molecular Weight: 757 aa, 81 kDa
• GenBank Accession Number: BC051340
• Gene Symbol: TEM1
• Gene ID (NCBI): 57124
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9HCU0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TEM1 (Tumor endothelial marker 1), also named as CD248, Endosialin and CD164L1, is a C-type lectin-like domain (CTLD) containing type I transmembrane glycoprotein. It is now considered to be a highly selective marker for activated perivascular and stromal cells, detected in most cancers and at least some inflammatory disorders. CD248 plays a role in tumor angiogenesis. It is a potential diagnostic tool and therapeutic target of inflammatory and malignant disease. Two isoforms of human TEM1 exist. The calculated molecular weights of the two isoforms are 81 kDa and 46 kDa, respectively. Native TEM1 can be glycosylated, and the glycosylated form has a larger apparent molecular weight than 81 kDa.