TFB2M Polyclonal antibody, PBS Only

• 

  WB analysis of mouse testis using 24411-1-AP (same clone as 24411-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 24411-1-AP (TFB2M Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24411-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 24411-1-AP (same clone as 24411-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 24411-1-AP (TFB2M Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24411-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TFB2M Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24411-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

24411-1-PBS targets TFB2M in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19687

  Product name: Recombinant human TFB2M protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 176-396 aa of BC003383

  Sequence: LGIEAVPWTADIPLKVVGMFPSRGEKRALWKLAYDLYSCTSIYKFGRIEVNMFIGEKEFQKLMADPGNPDLYHVLSVIWQLACEIKVLHMEPWSSFDIYTRKGPLENPKRRELLDQLQQKLYLIQMIPRQNLFTKNLTPMNYNIFFHLLKHCFGRRSATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMHPQDFKTLFETIERSKDCAYKWLYDETLEDR

• Full Name: transcription factor B2, mitochondrial
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC003383
• Gene Symbol: TFB2M
• Gene ID (NCBI): 64216
• RRID: AB_2879530
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H5Q4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TFB2M (mitochondrial transcription factor B2) is a novel nuclear-encoded protein that is necessary for transcription of mitochondrial DNA.