TFB2M Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TFB2M Polyclonal antibody (24411-1-AP)

• Featured Product
• KD/KO Validated

TFB2M Polyclonal Antibody for WB, ELISA

Cat No. 24411-1-AP Copied!

Publications (8)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, ELISA

Synonyms

h mtTFB, h mtTFB2, Hkp1, hTFB2M, mtTFB2, NS5ATP5, TFB2M

• 

  WB analysis of mouse testis using 24411-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 24411-1-AP (TFB2M Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 24411-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24411-1-AP (TFB2M antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse testis using 24411-1-AP

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 24411-1-AP (TFB2M Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TFB2M in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24411-1-AP targets TFB2M in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19687

  Product name: Recombinant human TFB2M protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 176-396 aa of BC003383

  Sequence: LGIEAVPWTADIPLKVVGMFPSRGEKRALWKLAYDLYSCTSIYKFGRIEVNMFIGEKEFQKLMADPGNPDLYHVLSVIWQLACEIKVLHMEPWSSFDIYTRKGPLENPKRRELLDQLQQKLYLIQMIPRQNLFTKNLTPMNYNIFFHLLKHCFGRRSATVIDHLRSLTPLDARDILMQIGKQEDEKVVNMHPQDFKTLFETIERSKDCAYKWLYDETLEDR

• Full Name: transcription factor B2, mitochondrial
• Calculated Molecular Weight: 45 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC003383
• Gene Symbol: TFB2M
• Gene ID (NCBI): 64216
• RRID: AB_2879530
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H5Q4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TFB2M (mitochondrial transcription factor B2) is a novel nuclear-encoded protein that is necessary for transcription of mitochondrial DNA.

Publications

What published studies show

The TFB2M Polyclonal antibody (catalog 24411-1-AP) has 8 citations, all in WB applications. They appear in Molecular Cell, Nature Chemical Biology, Nucleic Acids Research, Cell Death & Disease, Cells, Biochimica et Biophysica Acta – Molecular Basis of Disease, iScience, and Mitochondrion. Research fields span mitochondrial transcription and mtDNA replication, spliceosomal proofreading, tumor exosomes and ferroptosis, ovarian and breast cancer, mitochondrial biogenesis and hearing, and mitochondrial respiratory chain quality control.

Automatically generated from the 8 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Cell; Spliceosomal proofreading factors safeguard 3' splice-site fidelity and prevent proteotoxicity and inflammation; Authors - Fangshu Li
human	WB	Nat Chem Biol; Mitochondria-localized MBD2c facilitates mtDNA transcription and drug resistance; Authors - Yijie Hao
zebrafish	WB	Nucleic Acids Res; Deletion of Mtu1 (Trmu) in zebrafish revealed the essential role of tRNA modification in mitochondrial biogenesis and hearing function.; Authors - Qinghai Zhang
human	WB	Cell Death Dis; Hypoxic tumor exosomes suppress macrophage inflammation and ferroptosis via NDUFV2 to enhance bystander tumor radioresistance.; Authors - Jialing Zhang
human	WB	Cells; A Method for In Situ Reverse Genetic Analysis of Proteins Involved mtDNA Replication; Authors - Natalya Kozhukhar ; KO Validated
human	WB	Biochim Biophys Acta Mol Basis Dis; LARP1, an RNA-binding protein, participates in ovarian cancer cell survival by regulating mitochondrial oxidative phosphorylation in response to the influence of the PI3K/mTOR pathway; Authors - Jiaoyan Ma