Product Information
66471-1-PBS targets TFF2 in WB, Indirect ELISA applications and shows reactivity with human, pig, rat samples.
Tested Reactivity | human, pig, rat |
Host / Isotype | Mouse / IgG2a |
Class | Monoclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18765 Product name: Recombinant human TFF2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-129 aa of BC032820 Sequence: MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY Predict reactive species |
Full Name | trefoil factor 2 |
Calculated Molecular Weight | 129 aa, 14 kDa |
Observed Molecular Weight | 16 kDa |
GenBank Accession Number | BC032820 |
Gene Symbol | TFF2 |
Gene ID (NCBI) | 7032 |
RRID | AB_2881837 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q03403 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
The trefoil factor family (TFF), comprises of three polypeptides, TFF1, TFF2 and TFF3 (7-12 kDa), secreted to mucosal surfaces by mucus producing cells, prominently in the gastrointestinal tract. TFF2, also known as spasmolytic polypeptide, is a low-molecular weight protein, expressed in mucous neck cells of the fundus and glands at the base of the antrum in normal human stomach. TFF2 could Inhibit gastrointestinal motility and gastric acid secretion. However, recent studies suggest that TFF2 could also play an important role in the immune system.