TFG Monoclonal antibody

TFG Monoclonal Antibody for WB, IHC, ELISA
Cat No. 66916-1-Ig
Clone No.1B5B9

Host / Isotype

Mouse / IgG2b

Reactivity

Human, Pig

Applications

WB, IHC, ELISA

FLJ36137, Protein TFG, TF6, TFG, TRK fused gene, TRK fused gene protein, TRKT3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNCI-H1299 cells, A549 cells, MCF-7 cells, HEK-293 cells, PC-3 cells, LNCaP cells
Positive IHC detected inhuman breast cancer tissue, human prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66916-1-Ig targets TFG in WB, IHC, ELISA applications and shows reactivity with Human, Pig samples.

Tested Reactivity Human, Pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27697

Product name: Recombinant human TFG protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-208 aa of BC023599

Sequence: MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPSAPAEDRSGTPD

Predict reactive species
Full Name TRK-fused gene
Calculated Molecular Weight 400 aa, 43 kDa
Observed Molecular Weight 50-55 kDa
GenBank Accession NumberBC023599
Gene Symbol TFG
Gene ID (NCBI) 10342
RRIDAB_2882243
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ92734
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Protein TFG (TRK-fused gene protein) plays a role in regulating phosphotyrosine-specific phosphatase-1 activity. Mutations in TFG may have important clinical relevance for current therapeutic strategies to treat metastatic melanoma. Defects in TFG are a cause of thyroid papillary carcinoma (TPC), a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Hereditary motor and sensory neuropathy with proximal dominant involvement (HMSN-P) is an autosomal-dominant neurodegenerative disorder characterized by widespread fasciculations, proximal-predominant muscle weakness, and atrophy followed by distal sensory involvement. Recent genetic investigation indicates that formation of TFG-containing cytoplasmic inclusions and concomitant mislocalization of TAR DNA-binding protein 43 kDa (TDP-43) underlie motor neuron degeneration in HMSN-P. Pathological overlap of proteinopathies involving TFG and TDP-43 highlights a new pathway leading to motor neuron degeneration.

Protocols

Product Specific Protocols
IHC protocol for TFG antibody 66916-1-IgDownload protocol
WB protocol for TFG antibody 66916-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...