TFG Monoclonal antibody, PBS Only (Capture)

TFG Monoclonal Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 66916-1-PBS
Clone No.1B5B9

Host / Isotype

Mouse / IgG2b

Reactivity

human, pig

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

TRKT3, TRK-fused gene protein, TRK fused gene protein, TRK fused gene, TF6

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66916-1-PBS targets TFG as part of a matched antibody pair:

MP50894-1: 66916-1-PBS capture and 66916-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag27697

Product name: Recombinant human TFG protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-208 aa of BC023599

Sequence: MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPSAPAEDRSGTPD

Predict reactive species
Full Name TRK-fused gene
Calculated Molecular Weight 400 aa, 43 kDa
Observed Molecular Weight 50-55 kDa
GenBank Accession NumberBC023599
Gene Symbol TFG
Gene ID (NCBI) 10342
RRIDAB_2882243
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ92734
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Protein TFG (TRK-fused gene protein) plays a role in regulating phosphotyrosine-specific phosphatase-1 activity. Mutations in TFG may have important clinical relevance for current therapeutic strategies to treat metastatic melanoma. Defects in TFG are a cause of thyroid papillary carcinoma (TPC), a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Hereditary motor and sensory neuropathy with proximal dominant involvement (HMSN-P) is an autosomal-dominant neurodegenerative disorder characterized by widespread fasciculations, proximal-predominant muscle weakness, and atrophy followed by distal sensory involvement. Recent genetic investigation indicates that formation of TFG-containing cytoplasmic inclusions and concomitant mislocalization of TAR DNA-binding protein 43 kDa (TDP-43) underlie motor neuron degeneration in HMSN-P. Pathological overlap of proteinopathies involving TFG and TDP-43 highlights a new pathway leading to motor neuron degeneration.

Loading...
||
New chat Able
正在加载,请稍候...