TFPI2 Polyclonal antibody

• 

  WB analysis using 30689-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30689-1-AP (TFPI2 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

TFPI2 Polyclonal Antibody for WB, ELISA

Cat No. 30689-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

TFPI 2, REF1, PP5, Placental protein 5

---

Tested Applications

• Positive WB detected in: human placenta tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30689-1-AP targets TFPI2 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33467

  Product name: Recombinant human TFPI2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 71-190 aa of NM_001271003.1

  Sequence: GNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTG

• Full Name: tissue factor pathway inhibitor 2
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 27-36 kDa
• GenBank Accession Number: NM_001271003.1
• Gene Symbol: TFPI2
• Gene ID (NCBI): 7980
• RRID: AB_3669750
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P48307
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TFPI2 (tissue factor pathway inhibitor 2), also known as PP5. It is expected to be located in extracellular space, and the protein is enriched in the placenta. This gene encodes a member of the Kunitz-type serine proteinase inhibitor family. The protein can inhibit a variety of serine proteases including factor VIIa/tissue factor, factor Xa, plasmin, trypsin, chymotrypsin and plasma kallikrein. This gene has been identified as a tumor suppressor gene in several types of cancer. The molecular weight of TFPI2 is 27 kDa, and it can recognize the band of 36 kDa (PMID: 21421890).