TFPI2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of human placenta using 83279-1-RR (same clone as 83279-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 83279-1-RR (TFPI2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83279-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83279-1-PBS

  Biolayer interferometry (BLl) kinetic assays of 83279-1-RR against Human TFPI2 were performed. The affinity constant is below 1 pM.

TFPI2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 83279-1-PBS

Clone No.230135E3

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

TFPI 2, REF1, PP5, Placental protein 5, 230135E3

---

Product Information

83279-1-PBS targets TFPI2 in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33467

  Product name: Recombinant human TFPI2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 71-190 aa of NM_001271003.1

  Sequence: GNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTG

• Full Name: tissue factor pathway inhibitor 2
• Calculated Molecular Weight: 27 kDa
• GenBank Accession Number: NM_001271003.1
• Gene Symbol: TFPI2
• Gene ID (NCBI): 7980
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P48307
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.