TFPI2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of human placenta using 83279-1-RR (same clone as 83279-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 83279-1-RR (TFPI2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83279-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83279-1-PBS

  Biolayer interferometry (BLl) kinetic assays of 83279-1-RR against Human TFPI2 were performed. The affinity constant is below 1 pM.

• KD/KO Validated

TFPI2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 83279-1-PBS

Clone No.230135E3

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

TFPI 2, REF1, PP5, Placental protein 5, 230135E3

---

Product Information

83279-1-PBS targets TFPI2 in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag33467

  Product name: Recombinant human TFPI2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 71-190 aa of NM_001271003.1

  Sequence: GNANNFYTWEACDDACWRIEKVPKVCRLQVSVDDQCEGSTEKYFFNLSSMTCEKFFSGGCHRNRIENRFPDEATCMGFCAPKKIPSFCYSPKDEGLCSANVTRYYFNPRYRTCDAFTYTG

• Full Name: tissue factor pathway inhibitor 2
• Calculated Molecular Weight: 27 kDa
• GenBank Accession Number: NM_001271003.1
• Gene Symbol: TFPI2
• Gene ID (NCBI): 7980
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P48307
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TFPI2 (tissue factor pathway inhibitor 2), also known as PP5. It is expected to be located in extracellular space, and the protein is enriched in the placenta. This gene encodes a member of the Kunitz-type serine proteinase inhibitor family. The protein can inhibit a variety of serine proteases including factor VIIa/tissue factor, factor Xa, plasmin, trypsin, chymotrypsin and plasma kallikrein. This gene has been identified as a tumor suppressor gene in several types of cancer. The molecular weight of TFPI2 is 27 kDa, and it can recognize the band of 36 kDa (PMID: 21421890).