TH1L Polyclonal antibody, PBS Only

• 

  WB analysis using 28417-1-AP (same clone as 28417-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28417-1-AP (TH1L antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28417-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 28417-1-AP (same clone as 28417-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 28417-1-AP (TH1L antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 28417-1-PBS in a different storage buffer formulation.

TH1L Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 28417-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

28417-1-PBS targets TH1L in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29262

  Product name: Recombinant human TH1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 9-150 aa of BC014952

  Sequence: IMDEDYYGSAAEWGDEADGGQQEDDSGEGEDDAEVQQECLHKFSTRDYIMEPSIFNTLKRYFQAGGSPENVIQLLSENYTAVAQTVNLLAEWLIQTGVEPVQVQETVENHLKSLLIKHFDPRKADSIFTEEGETPAWLEQMI

• Full Name: TH1-like (Drosophila)
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC014952
• Gene Symbol: TH1L
• Gene ID (NCBI): 51497
• RRID: AB_2881137
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IXH7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.