TH1L Polyclonal antibody

• 

  WB analysis using 28417-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 28417-1-AP (TH1L antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 28417-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 28417-1-AP (TH1L antibody) at dilution of 1:100 and CoraLite488-Conjugated Goat Anti-Rabbit IgG(H+L).

TH1L Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 28417-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human

Applications

WB, IF/ICC, ELISA

Synonyms

HSPC130, Negative elongation factor C/D, NELF C, NELF C/D, NELF D, NELFD, TH1, TH1 like (Drosophila), TH1 like protein, TH1L

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, MCF-7 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

28417-1-AP targets TH1L in WB, IF/ICC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29262

  Product name: Recombinant human TH1L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 9-150 aa of BC014952

  Sequence: IMDEDYYGSAAEWGDEADGGQQEDDSGEGEDDAEVQQECLHKFSTRDYIMEPSIFNTLKRYFQAGGSPENVIQLLSENYTAVAQTVNLLAEWLIQTGVEPVQVQETVENHLKSLLIKHFDPRKADSIFTEEGETPAWLEQMI

• Full Name: TH1-like (Drosophila)
• Calculated Molecular Weight: 66 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC014952
• Gene Symbol: TH1L
• Gene ID (NCBI): 51497
• RRID: AB_2881137
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IXH7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.