Tested Applications
| Positive WB detected in | HEK-293 cells, mouse testis tissue | 
| Positive IF/ICC detected in | Hela cells, HepG2 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below | 
Product Information
20853-1-AP targets THAP2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse | 
| Cited Reactivity | human, rat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag14775 Product name: Recombinant human THAP2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 83-228 aa of BC008358 Sequence: CTHIKSMKLKSRNLLKKNNSCSPAGPSNLKSNISSQQVLLEHSYAFRNPMEAKKRIIKLEKEIASLRRKMKTCLQKERRATRRWIKATCLVKNLEANSVLPKGTSEHMLPTALSSLPLEDFKILEQDQQDKTLLSLNLKQTKSTFI Predict reactive species | 
                                    
| Full Name | THAP domain containing, apoptosis associated protein 2 | 
| Calculated Molecular Weight | 228 aa, 26 kDa | 
| Observed Molecular Weight | 26-30 kDa | 
| GenBank Accession Number | BC008358 | 
| Gene Symbol | THAP2 | 
| Gene ID (NCBI) | 83591 | 
| RRID | AB_10732806 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | Q9H0W7 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
THAP2, also named as THAP domain-containing protein 2, is a 228 amino acid protein, which contains one THAP-type zinc finger. Members of the THAP (thanatos-associated protein) family of proteins contain a well conserved DNA-binding domain known as the THAP-type zinc finger motif. Proteins containing the THAP-type zinc finger motif are commonly involved in transcriptional regulation, cell-cycle control, apoptosis and chromatin modification
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for THAP2 antibody 20853-1-AP | Download protocol | 
| WB protocol for THAP2 antibody 20853-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Cancer Cell Int The involvement of miR-100 in bladder urothelial carcinogenesis changing the expression levels of mRNA and proteins of genes related to cell proliferation, survival, apoptosis and chromosomal stability. | ||







