THOC3 Monoclonal antibody

• 

  WB analysis using 68812-3-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68812-3-Ig (THOC3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 68812-3-Ig

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 68812-3-Ig (THOC3 antibody) at dilution of 1:4000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of A431 using 68812-3-Ig

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using THOC3 antibody (68812-3-Ig, Clone: 1A5B12 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red).

THOC3 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 68812-3-Ig

Clone No.1A5B12

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

hTREX45, TEX1, Tho3

---

Tested Applications

• Positive WB detected in: MCF-10A cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:2000-1:8000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68812-3-Ig targets THOC3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35578

  Product name: Recombinant human THOC3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-348 aa of BC006849

  Sequence: MAVPAAAMGPSALGQSGPGSMAPWCSVSSGPSRYVLGMQELFRGHSKTREFLAHSAKVHSVAWSCDGRRLASGSFDKTASVFLLEKDRLVKENNYRGHGDSVDQLCWHPSNPDLFVTASGDKTIRIWDVRTTKCIATVNTKGENINICWSPDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISWNNDNNMFFLTNGNGCINILSYPELKPVQSINAHPSNCICIKFDPMGKYFATGSADALVSLWDVDELVCVRCFSRLDWPVRTLSFSHDGKMLASASEDHFIDIAEVETGDKLWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLP

• Full Name: THO complex 3
• Calculated Molecular Weight: 327 aa, 36 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC006849
• Gene Symbol: THOC3
• Gene ID (NCBI): 84321
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96J01
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

THOC3 is a component of the nuclear THO transcription elongation complex, which is a part of the larger transcription export (TREX) complex that couples messenger RNA processing and export. Additionally, THOC3 plays a key role in many cellular mechanisms, such as in the pathogenesis of cancer and neurodegenerative diseases (PMID: 36674977). THOC3 has 2 isoforms with the molecular weights of 36 kDa and 39 kDa.