THOC3 Monoclonal antibody, PBS Only

• 

  WB analysis using 68812-3-Ig (same clone as 68812-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68812-3-Ig (THOC3 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68812-3-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary cancer using 68812-3-Ig (same clone as 68812-3-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 68812-3-Ig (THOC3 antibody) at dilution of 1:4000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68812-3-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 68812-3-Ig (same clone as 68812-3-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using THOC3 antibody (68812-3-Ig, Clone: 1A5B12 ) at dilution of 1:1000 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red). This data was developed using the same antibody clone with 68812-3-PBS in a different storage buffer formulation.

THOC3 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 68812-3-PBS

Clone No.1A5B12

Host / Isotype

Mouse / IgG2b

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

hTREX45, TEX1, Tho3

---

Product Information

68812-3-PBS targets THOC3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35578

  Product name: Recombinant human THOC3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-348 aa of BC006849

  Sequence: MAVPAAAMGPSALGQSGPGSMAPWCSVSSGPSRYVLGMQELFRGHSKTREFLAHSAKVHSVAWSCDGRRLASGSFDKTASVFLLEKDRLVKENNYRGHGDSVDQLCWHPSNPDLFVTASGDKTIRIWDVRTTKCIATVNTKGENINICWSPDGQTIAVGNKDDVVTFIDAKTHRSKAEEQFKFEVNEISWNNDNNMFFLTNGNGCINILSYPELKPVQSINAHPSNCICIKFDPMGKYFATGSADALVSLWDVDELVCVRCFSRLDWPVRTLSFSHDGKMLASASEDHFIDIAEVETGDKLWEVQCESPTFTVAWHPKRPLLAFACDDKDGKYDSSREAGTVKLFGLP

• Full Name: THO complex 3
• Calculated Molecular Weight: 327 aa, 36 kDa
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC006849
• Gene Symbol: THOC3
• Gene ID (NCBI): 84321
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96J01
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

THOC3 is a component of the nuclear THO transcription elongation complex, which is a part of the larger transcription export (TREX) complex that couples messenger RNA processing and export. Additionally, THOC3 plays a key role in many cellular mechanisms, such as in the pathogenesis of cancer and neurodegenerative diseases (PMID: 36674977). THOC3 has 2 isoforms with the molecular weights of 36 kDa and 39 kDa.