THPO Recombinant monoclonal antibody, PBS Only

• 

  Affinity of 85767-3-PBS

  Biolayer interferometry (BLI) kinetic assay of 85767-3-PBS against Human THPO was performed. The affinity constant is 2.64 nM.

THPO Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 85767-3-PBS

Clone No.250028G11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

thrombopoietin, TPO

---

Product Information

85767-3-PBS targets THPO in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2941

  Product name: Recombinant Human THPO protein (rFc Tag)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 22-353 aa of NM_000460.3

  Sequence: SPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG

• Full Name: thrombopoietin
• Calculated Molecular Weight: 38 kDa
• GenBank Accession Number: NM_000460.3
• Gene Symbol: Thrombopoietin
• Gene ID (NCBI): 7066
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P40225-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.