THYN1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68337-1-Ig (same clone as 68337-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68337-1-Ig (THYN1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 68337-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 68337-1-Ig (same clone as 68337-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68337-1-Ig (THYN1 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Beta Actin Monoclonal antibody (HRP-66009) as loading control. This data was developed using the same antibody clone with 68337-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 68337-1-Ig (same clone as 68337-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 68337-1-Ig (THYN1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68337-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 68337-1-Ig (same clone as 68337-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 68337-1-Ig (THYN1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68337-1-PBS in a different storage buffer formulation.

THYN1 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 68337-1-PBS

Clone No.1E12G3

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, IHC, Indirect ELISA

Synonyms

HSPC144, MDS012, My0054, MY105, THY28, THY28KD, thymocyte nuclear protein 1, Thymocyte protein Thy28, THYN1

---

Product Information

68337-1-PBS targets THYN1 in WB, IHC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8617

  Product name: Recombinant human THYN1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-166 aa of BC006978

  Sequence: MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMKSLILF

• Full Name: thymocyte nuclear protein 1
• Calculated Molecular Weight: 225aa,26 kDa; 166aa,19 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC006978
• Gene Symbol: THYN1
• Gene ID (NCBI): 29087
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9P016
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

THYN1, also named as THY28, is a 28-32 kDa protein which located mainly in the nucleus. It appears to correlate with induction of apoptosis. (PMID:14601557)