Tested Applications
Positive WB detected in | PC-3 cells |
Positive IHC detected in | human skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | PC-3 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IHC | See 1 publications below |
Product Information
20328-1-AP targets TIAF1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14023 Product name: Recombinant human TIAF1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-115 aa of BC131561 Sequence: MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG Predict reactive species |
Full Name | TGFB1-induced anti-apoptotic factor 1 |
Calculated Molecular Weight | 115 aa, 12 kDa |
Observed Molecular Weight | 12 kDa |
GenBank Accession Number | BC131561 |
Gene Symbol | TIAF1 |
Gene ID (NCBI) | 9220 |
RRID | AB_10858233 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O95411 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TIAF1 antibody 20328-1-AP | Download protocol |
IHC protocol for TIAF1 antibody 20328-1-AP | Download protocol |
IF protocol for TIAF1 antibody 20328-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Oncogenesis HOXC8 promotes proliferation and migration through transcriptional up-regulation of TGFβ1 in non-small cell lung cancer. | ||
Mol Carcinog Upregulation of MGP by HOXC8 promotes the proliferation, migration, and EMT processes of triple-negative breast cancer. |