TIAF1 Polyclonal antibody, PBS Only

• 

  WB analysis of PC-3 using 20328-1-AP (same clone as 20328-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 20328-1-AP (TIAF1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20328-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 20328-1-AP (same clone as 20328-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 20328-1-AP (TIAF1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20328-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 20328-1-AP (same clone as 20328-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 20328-1-AP (TIAF1 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 20328-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 20328-1-AP (same clone as 20328-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 20328-1-AP (TIAF1 antibody) at dilution of 1:100 (under 40x lens). This data was developed using the same antibody clone with 20328-1-PBS in a different storage buffer formulation.

• 

  IF Staining of PC-3 using 20328-1-AP (same clone as 20328-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde) fixed PC-3 cells using 20328-1-AP (TIAF1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 20328-1-PBS in a different storage buffer formulation.

TIAF1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 20328-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

20328-1-PBS targets TIAF1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14023

  Product name: Recombinant human TIAF1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-115 aa of BC131561

  Sequence: MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG

• Full Name: TGFB1-induced anti-apoptotic factor 1
• Calculated Molecular Weight: 115 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC131561
• Gene Symbol: TIAF1
• Gene ID (NCBI): 9220
• RRID: AB_10858233
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95411
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.