TIGD5 Polyclonal antibody

TIGD5 Polyclonal Antibody for WB, ELISA
Cat No. 13644-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

TIGD5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WBSee 2 publications below

Product Information

13644-1-AP targets TIGD5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4590

Product name: Recombinant human TIGD5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-274 aa of BC032632

Sequence: MPALDSEDAPVRCRPEPLGPPEELQTPDGAVRVLFLSKGSSRAHIPAPLEQGVVAAFKQLYKRELLRLAVSCASGSPLDFMRSFMLKDMLYLAGLSWDLVQAGSIERCWLLGLRAAFEPRPGEDSAGQPAQAEEAAEHSRVLSDLTHLAALAYKCLAPEEVAEWLHLDDDGGPPEGCREEVGPALPPAAPPAPASLPSAIGGGEDEEEATDYGGTSVPTAGEAVRGLETALRWLENQDPREVGPLRLVQLRSLISMARRLGGIWHTPAGPYDGV

Predict reactive species
Full Name tigger transposable element derived 5
Calculated Molecular Weight 593 aa, 65 kDa
Observed Molecular Weight 65-70 kDa
GenBank Accession NumberBC032632
Gene Symbol TIGD5
Gene ID (NCBI) 84948
RRIDAB_2271647
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ53EQ6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
WB protocol for TIGD5 antibody 13644-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Genes Cells

The TIGD5 gene located in 8q24 and frequently amplified in ovarian cancers is a tumor suppressor

Authors - Yuntao Dai
humanWB

Elife

Quantitative mapping of proteasome interactomes and substrates using ProteasomeID

Authors - Aleksandar Bartolome
Loading...
||
New chat Able
正在加载,请稍候...