TIGD5 Polyclonal antibody

• 

  WB analysis of HeLa using 13644-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 13644-1-AP (TIGD5 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

TIGD5 Polyclonal Antibody for WB, ELISA

Cat No. 13644-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

TIGD5

---

Tested Applications

• Positive WB detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

13644-1-AP targets TIGD5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4590

  Product name: Recombinant human TIGD5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-274 aa of BC032632

  Sequence: MPALDSEDAPVRCRPEPLGPPEELQTPDGAVRVLFLSKGSSRAHIPAPLEQGVVAAFKQLYKRELLRLAVSCASGSPLDFMRSFMLKDMLYLAGLSWDLVQAGSIERCWLLGLRAAFEPRPGEDSAGQPAQAEEAAEHSRVLSDLTHLAALAYKCLAPEEVAEWLHLDDDGGPPEGCREEVGPALPPAAPPAPASLPSAIGGGEDEEEATDYGGTSVPTAGEAVRGLETALRWLENQDPREVGPLRLVQLRSLISMARRLGGIWHTPAGPYDGV

• Full Name: tigger transposable element derived 5
• Calculated Molecular Weight: 593 aa, 65 kDa
• Observed Molecular Weight: 65-70 kDa
• GenBank Accession Number: BC032632
• Gene Symbol: TIGD5
• Gene ID (NCBI): 84948
• RRID: AB_2271647
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q53EQ6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Genes Cells; The TIGD5 gene located in 8q24 and frequently amplified in ovarian cancers is a tumor suppressor; Authors - Yuntao Dai
human	WB	Elife; Quantitative mapping of proteasome interactomes and substrates using ProteasomeID; Authors - Aleksandar Bartolome