TIMM17A Polyclonal antibody, PBS Only

• 

  WB analysis using 11189-1-AP (same clone as 11189-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11189-1-AP (TIMM17A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11189-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 11189-1-AP (same clone as 11189-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11189-1-AP (TIMM17A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11189-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 11189-1-AP (same clone as 11189-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11189-1-AP (TIMM17A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11189-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TIMM17A Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11189-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

11189-1-PBS targets TIMM17A in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1665

  Product name: Recombinant human TIMM17A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-171 aa of BC015098

  Sequence: MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ

• Full Name: translocase of inner mitochondrial membrane 17 homolog A (yeast)
• Calculated Molecular Weight: 18 kDa
• Observed Molecular Weight: 18 kDa
• GenBank Accession Number: BC015098
• Gene Symbol: TIMM17A
• Gene ID (NCBI): 10440
• RRID: AB_2271661
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99595
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.