Tested Applications
| Positive WB detected in | HeLa cells, Neuro-2a cells, C6 cells, Jurkat cells |
| Positive IP detected in | HeLa cells, mouse heart tissue |
| Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 24 publications below |
| IF | See 6 publications below |
| IP | See 1 publications below |
Product Information
13859-1-AP targets TIMM44 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4834 Product name: Recombinant human TIMM44 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 153-452 aa of BC033628 Sequence: AKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKFKEEKVFEPNEEALGVVLHKDSKWYQQWKDFKENNVVFNRFFEMKMKYDESDNAFIRASRALTDKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATYSQLAHPIQQAKALGLQFHSRILDIDNVDLAMGKMMEQGPVLIITFQAQLVMVVRNPKGEVVEGDPDKVLRMLYVWALCRDQDELNPYAAWRLLDISASSTEQIL Predict reactive species |
| Full Name | translocase of inner mitochondrial membrane 44 homolog (yeast) |
| Calculated Molecular Weight | 452 aa, 51 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | BC033628 |
| Gene Symbol | TIMM44 |
| Gene ID (NCBI) | 10469 |
| RRID | AB_2204679 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43615 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Translocase of inner mitochondrial membrane 44 (TIMM44), also known as MIMT44 and TIM44, belongs to the Tim44 family. TIMM44 is a mitochondrial protein located at the inner mitochondrial membrane, which is crucial for the integrity and function of mitochondria. In an ATP-dependent manner, TIMM44 anchors mitochondrial heat shock protein 70 to the translocase of the mitochondrial inner membrane 23 (TIMM23) complex. TIMM44 is essential for mitochondrial pre-protein import into the mitochondrial matrix. TIMM44 is vital for the integrity and function of mitochondria. TIMM44 silencing disrupted mitochondrial functions in endothelial cells, causing mitochondrial protein input arrest, ATP reduction, ROS production, and mitochondrial depolarization, and leading to apoptosis activation (PMID: 36438483, PMID: 37147302, PMID: 38467612). The observed molecular weight of TIMM44 is 45 kDa, indicating a mature form of TIMM44 (PMID: 33891006).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TIMM44 antibody 13859-1-AP | Download protocol |
| IHC protocol for TIMM44 antibody 13859-1-AP | Download protocol |
| IP protocol for TIMM44 antibody 13859-1-AP | Download protocol |
| WB protocol for TIMM44 antibody 13859-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Metab Quantitative high-confidence human mitochondrial proteome and its dynamics in cellular context. | ||
Nat Cell Biol PARL mediates Smac proteolytic maturation in mitochondria to promote apoptosis. | ||
Mol Cell Balancing of mitochondrial translation through METTL8-mediated m3C modification of mitochondrial tRNAs. | ||
Nat Commun Protein import motor complex reacts to mitochondrial misfolding by reducing protein import and activating mitophagy | ||
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Morgane (Verified Customer) (09-16-2025) | Enriched in mitochondrial fractionning, migrates at the expected size, very clear signal
![]() |
FH Lana (Verified Customer) (04-20-2019) | SDS-PAGE:15 ug/ul RIPA lysate of the mitochondrial fraction of ST-Hdh-Q7/Q7 mouse striatal cell line4-12% Bis-tris gradient gelTransfer:Immobilon-FL transfer membranes (Millipore) O/N at 30V, 4CBlocking:SEA Block Blocking Buffer 1hPrimary Ab:O/N incubation at 4CSecondary Ab:IRDye 680LT Goat anti-Rabbit, 1h incubation at room temperature.Lines on WB:1. BioRad Precision Plus Protein standards2 and 3. Lysate of mitochondrial fraction of ST-Hdh-Q7/Q7 mouse striatal cell line.
![]() |

















