• Featured Product
  • KD/KO Validated

TIMM44 Polyclonal antibody

TIMM44 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 13859-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

TIMM 44, TIM44, MIMT44

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, Neuro-2a cells, C6 cells, Jurkat cells
Positive IP detected inHeLa cells, mouse heart tissue
Positive IHC detected inhuman liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:250-1:1000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13859-1-AP targets TIMM44 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4834

Product name: Recombinant human TIMM44 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 153-452 aa of BC033628

Sequence: AKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKFKEEKVFEPNEEALGVVLHKDSKWYQQWKDFKENNVVFNRFFEMKMKYDESDNAFIRASRALTDKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATYSQLAHPIQQAKALGLQFHSRILDIDNVDLAMGKMMEQGPVLIITFQAQLVMVVRNPKGEVVEGDPDKVLRMLYVWALCRDQDELNPYAAWRLLDISASSTEQIL

Predict reactive species
Full Name translocase of inner mitochondrial membrane 44 homolog (yeast)
Calculated Molecular Weight 452 aa, 51 kDa
Observed Molecular Weight 45 kDa
GenBank Accession NumberBC033628
Gene Symbol TIMM44
Gene ID (NCBI) 10469
RRIDAB_2204679
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO43615
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Translocase of inner mitochondrial membrane 44 (TIMM44), also known as MIMT44 and TIM44, belongs to the Tim44 family. TIMM44 is a mitochondrial protein located at the inner mitochondrial membrane, which is crucial for the integrity and function of mitochondria. In an ATP-dependent manner, TIMM44 anchors mitochondrial heat shock protein 70 to the translocase of the mitochondrial inner membrane 23 (TIMM23) complex. TIMM44 is essential for mitochondrial pre-protein import into the mitochondrial matrix. TIMM44 is vital for the integrity and function of mitochondria. TIMM44 silencing disrupted mitochondrial functions in endothelial cells, causing mitochondrial protein input arrest, ATP reduction, ROS production, and mitochondrial depolarization, and leading to apoptosis activation (PMID: 36438483, PMID: 37147302, PMID: 38467612). The observed molecular weight of TIMM44 is 45 kDa, indicating a mature form of TIMM44 (PMID: 33891006).

Protocols

Product Specific Protocols
WB protocol for TIMM44 antibody 13859-1-APDownload protocol
IHC protocol for TIMM44 antibody 13859-1-APDownload protocol
IF protocol for TIMM44 antibody 13859-1-APDownload protocol
IP protocol for TIMM44 antibody 13859-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell

Mitochondrial Protein Synthesis Adapts to Influx of Nuclear-Encoded Protein.

Authors - Ricarda Richter-Dennerlein
humanWB

Cell Metab

Quantitative high-confidence human mitochondrial proteome and its dynamics in cellular context.

Authors - Marcel Morgenstern
humanWB

Nat Cell Biol

PARL mediates Smac proteolytic maturation in mitochondria to promote apoptosis.

Authors - Shotaro Saita
humanWB

Mol Cell

Balancing of mitochondrial translation through METTL8-mediated m3C modification of mitochondrial tRNAs.

Authors - Eva Schöller
humanWB

Nat Commun

Protein import motor complex reacts to mitochondrial misfolding by reducing protein import and activating mitophagy

Authors - Jonas Benjamin Michaelis
humanWB

Nat Commun

LONP1 and mtHSP70 cooperate to promote mitochondrial protein folding.

Authors - Chun-Shik Shin

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Lana (Verified Customer) (04-20-2019)

SDS-PAGE:15 ug/ul RIPA lysate of the mitochondrial fraction of ST-Hdh-Q7/Q7 mouse striatal cell line4-12% Bis-tris gradient gelTransfer:Immobilon-FL transfer membranes (Millipore) O/N at 30V, 4CBlocking:SEA Block Blocking Buffer 1hPrimary Ab:O/N incubation at 4CSecondary Ab:IRDye 680LT Goat anti-Rabbit, 1h incubation at room temperature.Lines on WB:1. BioRad Precision Plus Protein standards2 and 3. Lysate of mitochondrial fraction of ST-Hdh-Q7/Q7 mouse striatal cell line.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: ST-Hdh mouse striatal cell line
TIMM44 Antibody Western Blot, validation (1:1000 dilution) in ST-Hdh mouse striatal cell line (Cat no:13859-1-AP)
Loading...