TIMM8A Polyclonal antibody

• Home
• Products
• Primary Antibodies
• TIMM8A Polyclonal antibody (11179-1-AP)

• Featured Product
• KD/KO Validated

TIMM8A Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11179-1-AP Copied!

Publications (10)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

TIM8A, DDP, DDP1, DFN1, MTS

• 

  WB analysis using 11179-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11179-1-AP (TIMM8A antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 11179-1-AP

  WB result of TIMM8A antibody (11179-1-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-TIMM8A transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse testis using 11179-1-AP

  IP result of anti-TIMM8A (IP:11179-1-AP, 4ug; Detection:11179-1-AP 1:500) with mouse testis tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat kidney using 11179-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 11179-1-AP (TIMM8A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat kidney using 11179-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 11179-1-AP (TIMM8A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 11179-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 11179-1-AP (TIMM8A antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human intrahepatic cholangiocarcinoma using 11179-1-AP

  Immunohistochemical analysis of paraffin-embedded human intrahepatic cholangiocarcinoma tissue slide using 11179-1-AP (TIMM8A antibody) at dilution of 1:400 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 11179-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using 11179-1-AP (TIMM8A antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TIMM8A in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse testis tissue, HeLa cells, rat testis tissue
• Positive IP detected in: mouse testis tissue
• Positive IHC detected in: human intrahepatic cholangiocarcinoma tissue, human stomach cancer tissue, rat kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11179-1-AP targets TIMM8A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1661

  Product name: Recombinant human TIMM8A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-97 aa of BC015093

  Sequence: MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD

• Full Name: translocase of inner mitochondrial membrane 8 homolog A (yeast)
• Calculated Molecular Weight: 11 kDa
• Observed Molecular Weight: 11 kDa
• GenBank Accession Number: BC015093
• Gene Symbol: TIMM8A
• Gene ID (NCBI): 1678
• RRID: AB_2204687
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60220
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TIMM8A (translocase of inner mitochondrial membrane 8A) is a mitochondrial intermembrane space chaperone that forms a 70 kDa hetero-hexamer with TIMM13 and escorts hydrophobic inner-membrane proteins from the cytosol into mitochondria. It acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIMM8-TIMM13 complex mediates the import of proteins such as TIMM23, SLC25A12/ARALAR1 and SLC25A13/ARALAR2, while the predominant TIMM9-TIMM10 70 kDa complex mediates the import of much more proteins. Probably necessary for normal neurologic development. (PMID: 11489896; 15254020)

Publications

What published studies show

The TIMM8A Polyclonal antibody (catalog number 11179-1-AP) has 10 total citations. These appear in journals including Nature, Molecular Cell, Genes & Diseases, Cell Death & Disease, Biomolecules, Scientific Reports, Oncology Research, Molecular Genetics & Genomic Medicine, and eLife. The associated research fields span neurodegeneration and stress response, mitochondrial function and amino acid uptake, mitochondrial DNA-related disorders (Mohr-Tranebjaerg syndrome), cancer biology (breast and lung), endoplasmic reticulum stress, and mitochondrial complex IV assembly.

Automatically generated from the 10 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Nature; Stress response silencing by an E3 ligase mutated in neurodegeneration; Authors - Diane L Haakonsen
		Mol Cell; SLC25A45 is required for mitochondrial uptake of methylated amino acids and de novo carnitine biosynthesis; Authors - Marilia M Dias
mouse	IF	Genes Dis; Cdc42 deletion yielded enamel defects by disrupting mitochondria and producing reactive oxygen species in dental epithelium; Authors - Jinxuan Zheng
human	WB	Cell Death Dis; CHCHD2 rescues the mitochondrial dysfunction in iPSC-derived neurons from patient with Mohr-Tranebjaerg syndrome; Authors - Yihua Huang ; KD Validated
	WB	Cell Death Dis; Haploinsufficiency in the mitochondrial protein CHCHD4 reduces brain injury in a mouse model of neonatal hypoxia-ischemia.; Authors - Yanyan Sun
		Biomolecules; TIM8 Deficiency in Yeast Induces Endoplasmic Reticulum Stress and Shortens the Chronological Lifespan; Authors - Dong Tang