Product Information
14804-1-AP targets TIMM8B in ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6521 Product name: Recombinant human TIMM8B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-56 aa of BC000711 Sequence: IVHHFMELCWDKCVEKPGNRLDSRTENCLSSCVDRFIDTTLAITSRFAQIVQKGGQ Predict reactive species |
| Full Name | translocase of inner mitochondrial membrane 8 homolog B (yeast) |
| Calculated Molecular Weight | 9 kDa |
| GenBank Accession Number | BC000711 |
| Gene Symbol | TIMM8B |
| Gene ID (NCBI) | 26521 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y5J9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
