TJAP1 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Cytometric bead array sample test of MP02865-1

  The mean TJAP1 concentration was determined to be 51.1 ng/mL in A431 cell extract based on a 1.2 mg/mL extract load, 28.8 ng/mL in HepG2 cell extract based on a 1.2 mg/mL extract load, 5.8 ng/mL in MG-63 cell extract based on a 1.2 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02865-1

  Cytometric bead array standard curve of MP02865-1, TJAP1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 87106-2-PBS. Detection antibody: 87106-1-PBS. Standard: Ag12174. Range: 0.312-20 ng/mL.

TJAP1 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Indirect ELISA

Cat No. 87106-1-PBS

Clone No.252301C11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Indirect ELISA

Synonyms

PILT, Tight junction-associated protein 1, TJAP 1, TJP4

---

Product Information

87106-1-PBS targets TJAP1 as part of a matched antibody pair:

MP02865-1: 87106-2-PBS capture and 87106-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag12174

  Product name: Recombinant human TJAP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC064401

  Sequence: MTSAAPAKKPYRKAPPEHRELRLEIPGSRLEQEEPLTDAERMKLLQEENEELRRRLASATRRTEALERELEIGQDCLELELGQSREELDKFKDKFRRLQNSYTASQRTNQELEDKLHTLIKKAEMDRKTLDWEIVELTNKLLDAKNTINKLEELNERYRLDCNLAVQLLKCNKSHFRNHKFADLPCELQDMVRKHLHSGQEAASPGPAPSLAPGAVVPTSVIARVLEKPESLLLNSAQSGSAGRPLAEDVFVHVDMSEGVPGDPASPPAPGSPTPQPNGECHSLGTARGSPEEELPLPAFEKLNPYPTPSPPHPLYPGRRVIEFSEDKVRIPRNSPLPNCTYATRQAISLS

• Full Name: tight junction associated protein 1 (peripheral)
• Calculated Molecular Weight: 547 aa, 61 kDa
• GenBank Accession Number: BC064401
• Gene Symbol: TJAP1
• Gene ID (NCBI): 93643
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q5JTD0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.