TLE1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 87332-1-RR (same clone as 87332-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 87332-1-RR (TLE1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87332-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 87332-1-RR (same clone as 87332-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87332-1-RR (TLE1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87332-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 87332-1-RR (same clone as 87332-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 87332-1-RR (TLE1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87332-1-PBS in a different storage buffer formulation.

• 

  Affinity of 87332-1-RR

  Biolayer interferometry (BLl) kinetic assays of 87332-1-RR against Human TLE1 were performed. The affinity constant is 1.29 nM.

TLE1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87332-1-PBS

Clone No.252574H3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

Enhancer of split groucho-like protein 1, GRG1, Transducin-like enhancer protein 1

---

Product Information

87332-1-PBS targets TLE1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag17299

  Product name: Recombinant human TLE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 281-377 aa of BC010100

  Sequence: KDASSSPASTASSASSTSLKSKEMSLHEKASTPVLKSSTPTPRSDMPTPGTSATPGLRPGLGKPPAIDPLVNQAAAGLRTPLAVPGPYPAPFGMVPH

• Full Name: transducin-like enhancer of split 1 (E(sp1) homolog, Drosophila)
• Calculated Molecular Weight: 770 aa, 83 kDa
• Observed Molecular Weight: 80-95 kDa
• GenBank Accession Number: BC010100
• Gene Symbol: TLE1
• Gene ID (NCBI): 7088
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q04724
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TLE1 (Transducin-like enhancer protein 1) is a transcriptional corepressor and binds to a number of transcription factors. It can inhibit NF-kappa-B-regulated gene expression and the transcriptional activation mediated by FOXA2, and by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES (PMID: 10660609). TLE1 is highly expressed in postnatal brain (PMID: 29758293; 27852056).