TLR4 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• TLR4 Monoclonal antibody (66350-1-Ig)

• Featured Product
• KD/KO Validated

TLR4 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66350-1-Ig

Clone No.3G9A4

Publications(377)

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig and More (5)

Applications

WB, IHC, IF, IP, CoIP, ELISA, Blocking assay

Synonyms

3G9A4, ARMD10, CD284, hToll, TOLL

• 

  WB analysis using 66350-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66350-1-Ig (TLR4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of RAW 264.7 using 66350-1-Ig

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 66350-1-Ig (TLR4 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of pig liver using 66350-1-Ig

  pig liver tissue were subjected to SDS PAGE followed by western blot with 66350-1-Ig (TLR4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat liver using 66350-1-Ig

  rat liver tissue were subjected to SDS PAGE followed by western blot with 66350-1-Ig (TLR4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 66350-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66350-1-Ig (TLR4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66350-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66350-1-Ig (TLR4 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 66350-1-Ig

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66350-1-Ig (TLR4 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: RAW 264.7 cells, J774A.1 cells, NIH/3T3 cells, pig liver tissue, rat liver tissue
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66350-1-Ig targets TLR4 in WB, IHC, IF, IP, CoIP, ELISA, Blocking assay applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse, rat, pig, rabbit, canine, zebrafish, goat, sheep
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13857

  Product name: Recombinant human TLR4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 653-839 aa of BC117422

  Sequence: KFYFHLMLLAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAANIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI

• Full Name: toll-like receptor 4
• Calculated Molecular Weight: 839 aa, 96 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC117422
• Gene Symbol: TLR4
• Gene ID (NCBI): 7099
• RRID: AB_2881730
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00206
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TLR4, also named CD284, belongs to the Toll-like receptor family. TLR4 interacts with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). TLR4 acts via MYD88, TIRAP and TRAF6, leading to NF-kB activation, cytokine secretion, and the inflammatory response. Three alternatively spliced transcript variants that encode different protein isoforms have been described.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Signal Transduct Target Ther; Innovative peptide-loaded hybrid membrane nanovaccine enables precise personalized immunotherapy for HPV-related cervical diseases.; Authors - Renjie Wang
		Cell; Tissue geometry spatiotemporally drives bacterial infections; Authors - Yiming Han
mouse	IF	Imeta; Akkermansia muciniphila-derived hypoacylated rough-type lipopolysaccharides alleviate diet-induced obesity via activation of TLR4-IL-23-IL-22 immune axis.; Authors - Li Sun
human	WB	J Natl Cancer Cent; S100A8 promotes tumor progression by inducing phenotypic polarization of microglia through the TLR4/IL-10 signaling pathway in glioma; Authors - Yuechao Yang
human	WB	Int J Oral Sci; Fibroblast membrane-camouflaged nanoparticles for inflammation treatment in the early stage.; Authors - Lizhong Sun
human	WB,CoIP	Exp Mol Med; Neutrophil extracellular traps mediate the crosstalk between plaque microenvironment and unstable carotid plaque formation; Authors - Yu Cao