TLR4 Monoclonal antibody, PBS Only

• 

  WB analysis using 66350-1-Ig (same clone as 66350-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66350-1-Ig (TLR4 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66350-1-PBS in a different storage buffer formulation.

• 

  WB analysis of RAW 264.7 using 66350-1-Ig (same clone as 66350-1-PBS)

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 66350-1-Ig (TLR4 Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66350-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig liver using 66350-1-Ig (same clone as 66350-1-PBS)

  pig liver tissue were subjected to SDS PAGE followed by western blot with 66350-1-Ig (TLR4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66350-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat liver using 66350-1-Ig (same clone as 66350-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 66350-1-Ig (TLR4 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66350-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 66350-1-Ig (same clone as 66350-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66350-1-Ig (TLR4 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66350-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66350-1-Ig (same clone as 66350-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66350-1-Ig (TLR4 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66350-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human tonsillitis using 66350-1-Ig (same clone as 66350-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 66350-1-Ig (TLR4 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66350-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TLR4 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 66350-1-PBS

Clone No.3G9A4

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, ELISA

Synonyms

3G9A4, ARMD10, CD284, hToll, TOLL

---

Product Information

66350-1-PBS targets TLR4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13857

  Product name: Recombinant human TLR4 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 653-839 aa of BC117422

  Sequence: KFYFHLMLLAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGVPPFQLCLHYRDFIPGVAIAANIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIVLQKVEKTLLRQQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI

• Full Name: toll-like receptor 4
• Calculated Molecular Weight: 839 aa, 96 kDa
• Observed Molecular Weight: 100-110 kDa
• GenBank Accession Number: BC117422
• Gene Symbol: TLR4
• Gene ID (NCBI): 7099
• RRID: AB_2881730
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00206
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TLR4, also named CD284, belongs to the Toll-like receptor family. TLR4 interacts with LY96 and CD14 to mediate the innate immune response to bacterial lipopolysaccharide (LPS). TLR4 acts via MYD88, TIRAP and TRAF6, leading to NF-kB activation, cytokine secretion, and the inflammatory response. Three alternatively spliced transcript variants that encode different protein isoforms have been described.