Product Information
21140-1-AP targets TM4SF20 in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag15594 Product name: Recombinant human TM4SF20 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 96-195 aa of BC035754 Sequence: IGALYCMLISIQALLKGPLMCNSPSNSNANCEFSLKNISDIHPESFNLQWFFNDSCAPPTGFNKPTSNDTMASGWRASSFHFDSEENKHRLIHFSVFLGL Predict reactive species |
| Full Name | transmembrane 4 L six family member 20 |
| Calculated Molecular Weight | 229 aa, 25 kDa |
| GenBank Accession Number | BC035754 |
| Gene Symbol | TM4SF20 |
| Gene ID (NCBI) | 79853 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q53R12 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
