TMBIM6 Polyclonal antibody

• 

  WB analysis of mouse liver using 26782-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 26782-1-AP (TMBIM6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse testis using 26782-1-AP

  IP result of anti-TMBIM6 (IP:26782-1-AP, 4ug; Detection:26782-1-AP 1:700) with mouse testis tissue lysate 3000ug.

• 

  IHC staining of human testis using 26782-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 26782-1-AP (TMBIM6 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human testis using 26782-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 26782-1-AP (TMBIM6 Antibody) at dilution of 1:200 (under 40x lens).

TMBIM6 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 26782-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, IP, ELISA

Synonyms

Bax inhibitor 1, BAXI1, BI 1, BI1, TEGT, TMBIM6

---

Tested Applications

• Positive WB detected in: mouse liver tissue
• Positive IP detected in: mouse testis tissue
• Positive IHC detected in: human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 6 publications below
• IHC: See 2 publications below
• IF: See 2 publications below

Product Information

26782-1-AP targets TMBIM6 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24780

  Product name: Recombinant human TMBIM6 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-86 aa of BC000916

  Sequence: MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLG

• Full Name: transmembrane BAX inhibitor motif containing 6
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC000916
• Gene Symbol: TMBIM6
• Gene ID (NCBI): 7009
• RRID: AB_2880633
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P55061
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Cell Physiol; Involvement of miR-27a-3p in diabetic nephropathy via affecting renal fibrosis, mitochondrial dysfunction, and endoplasmic reticulum stress.; Authors - Lina Wu
human,mouse	WB,IHC,IF	Mol Biol Rep; TMBIM6 promotes diabetic tubular epithelial cell survival and albumin endocytosis by inhibiting the endoplasmic reticulum stress sensor, IRE1α.; Authors - Huidi Xie
mouse	WB	Life Sci Alliance; The ADAM17 sheddase complex regulator iTAP/Frmd8 modulates inflammation and tumor growth; Authors - Marina Badenes
human	WB,IHC	Mol Med; Methyltransferase-like 3 aggravates endoplasmic reticulum stress in preeclampsia by targeting TMBIM6 in YTHDF2-dependent manner; Authors - Yangyang Chen
human	WB,IF	Eur J Med Chem; 13-oxyingenol dodecanoate derivatives induce mitophagy and ferroptosis through targeting TMBIM6 as potential anti-NSCLC agents; Authors - Yaxu Wang
human	WB	J Cancer; LncRNA SNHG1 acts as a ceRNA for miR-216a-3p to regulate TMBIM6 expression in esophageal squamous cell carcinoma; Authors - Ni Kong