Tested Applications
Positive WB detected in | mouse liver tissue |
Positive IP detected in | mouse testis tissue |
Positive IHC detected in | human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 6 publications below |
IHC | See 2 publications below |
IF | See 2 publications below |
Product Information
26782-1-AP targets TMBIM6 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24780 Product name: Recombinant human TMBIM6 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-86 aa of BC000916 Sequence: MNIFDRKINFDALLKFSHITPSTQQHLKKVYASFALCMFVAAAGAYVHMVTHFIQAGLLSALGSLILMIWLMATPHSHETEQKRLG Predict reactive species |
Full Name | transmembrane BAX inhibitor motif containing 6 |
Calculated Molecular Weight | 27 kDa |
Observed Molecular Weight | 27 kDa |
GenBank Accession Number | BC000916 |
Gene Symbol | TMBIM6 |
Gene ID (NCBI) | 7009 |
RRID | AB_2880633 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P55061 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TMBIM6 antibody 26782-1-AP | Download protocol |
IHC protocol for TMBIM6 antibody 26782-1-AP | Download protocol |
IP protocol for TMBIM6 antibody 26782-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Cell Physiol Involvement of miR-27a-3p in diabetic nephropathy via affecting renal fibrosis, mitochondrial dysfunction, and endoplasmic reticulum stress. | ||
Mol Biol Rep TMBIM6 promotes diabetic tubular epithelial cell survival and albumin endocytosis by inhibiting the endoplasmic reticulum stress sensor, IRE1α. | ||
Life Sci Alliance The ADAM17 sheddase complex regulator iTAP/Frmd8 modulates inflammation and tumor growth | ||
Mol Med Methyltransferase-like 3 aggravates endoplasmic reticulum stress in preeclampsia by targeting TMBIM6 in YTHDF2-dependent manner | ||
Eur J Med Chem 13-oxyingenol dodecanoate derivatives induce mitophagy and ferroptosis through targeting TMBIM6 as potential anti-NSCLC agents | ||
J Cancer LncRNA SNHG1 acts as a ceRNA for miR-216a-3p to regulate TMBIM6 expression in esophageal squamous cell carcinoma |