Tested Applications
| Positive WB detected in | A549 cells, L02 cells |
| Positive IHC detected in | human intrahepatic cholangiocarcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
27757-1-AP targets TMCO1 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26278 Product name: Recombinant human TMCO1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 111-188 aa of NM_019026 Sequence: MGRVVAKLPFTPLSYIQGLSHRNLLGDDTTDCSFIFLYILCTMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS Predict reactive species |
| Full Name | transmembrane and coiled-coil domains 1 |
| Calculated Molecular Weight | 21 kDa |
| Observed Molecular Weight | 21 kDa |
| GenBank Accession Number | NM_019026 |
| Gene Symbol | TMCO1 |
| Gene ID (NCBI) | 54499 |
| RRID | AB_2880962 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UM00 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMCO1, also known as TMCC4, PNAS-10, and PNAS-136, is a 188 amino acid protein, which is Widely expressed in adult and fetal tissues, with higher levels in thymus, prostate, testis and small intestine and lower levels in brain, placenta, lung and kidney (PubMed:10393320, PubMed:20018682). TMCO1 as a Calcium-selective channel is required to prevent calcium stores from overfilling, thereby playing a key role in calcium homeostasis (PubMed:27212239). In response to endoplasmic reticulum overloading, TMCO1, assembles into a homotetramer, forming a functional calcium-selective channel, regulating the calcium content in endoplasmic reticulum store (PubMed:27212239).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TMCO1 antibody 27757-1-AP | Download protocol |
| WB protocol for TMCO1 antibody 27757-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Open Life Sci The relationship between TMCO1 and CALR in the pathological characteristics of prostate cancer and its effect on the metastasis of prostate cancer cells | ||
bioRxiv Role of a holo-insertase complex in the biogenesis of biophysically diverse ER membrane proteins | ||
Cell Mol Biol (Noisy-le-grand) TMCO1 regulates cell proliferation, metastasis and EMT signaling through CALR, promoting ovarian cancer progression and cisplatin resistance |



