Tested Applications
| Positive WB detected in | A549 cells, HeLa cells, MKN-45 cells, NCI-H1299 cells, mouse liver tissue, rat liver tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30393-1-AP targets TMED5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33253 Product name: Recombinant human TMED5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 120-178 aa of BC070051 Sequence: IFFELILDNMGEQAQEQEDWKKYITGTDILDMKLEDILESINSIKSRLSKSGHIQILLR Predict reactive species |
| Full Name | transmembrane emp24 protein transport domain containing 5 |
| Observed Molecular Weight | 25 kDa |
| GenBank Accession Number | BC070051 |
| Gene Symbol | TMED5 |
| Gene ID (NCBI) | 50999 |
| RRID | AB_3086307 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y3A6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMED5 ( transmembrane p24 trafficking protein 5) is highly expressed in cervical and bladder cancer cell lines. TMED5 promotes nuclear autophagy and the malignant behavior of cervical cancer cells (PMID:36530030). Moreover, TMED5 could interact with WNT7B and thus activate the canonical WNT-CTNNB1/β-catenin signaling pathway (PMID:30394198).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TMED5 antibody 30393-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

