TMED9 Polyclonal antibody

• 

  WB analysis using 21620-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21620-1-AP (TMED9 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse pancreas using 21620-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 21620-1-AP (TMED9 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig liver using 21620-1-AP

  pig liver tissue were subjected to SDS PAGE followed by western blot with 21620-1-AP (TMED9 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 21620-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21620-1-AP (TMED9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 21620-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 21620-1-AP (TMED9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 21620-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 21620-1-AP (TMED9 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HepG2 using 21620-1-AP

  IP result of anti-TMED9 (IP:21620-1-AP, 4ug; Detection:21620-1-AP 1:4000) with HepG2 cells lysate 1600 ug.

• 

  IHC staining of human liver using 21620-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 21620-1-AP (TMED9 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 21620-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 21620-1-AP (TMED9 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 21620-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 21620-1-AP (TMED9 antibody) at dilution of 1:100 (under 40x lens).

• 

  IF Staining of HepG2 using 21620-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using TMED9 antibody (21620-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

• 

  IF Staining of HEK-293 using 21620-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using TMED9 antibody (21620-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

• Featured Product
• KD/KO Validated

TMED9 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 21620-1-AP

Publications(9)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

Glycoprotein 25L2, GMP25, GP25L2, p24 family protein alpha-2, p24alpha2

---

Tested Applications

• Positive WB detected in: HepG2 cells, L02 cells, pig liver tissue, mouse lung tissue, mouse pancreas tissue, mouse brain tissue, mouse liver tissue, rat liver tissue
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 4 publications below
• WB: See 8 publications below
• IHC: See 1 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below

Product Information

21620-1-AP targets TMED9 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13813

  Product name: Recombinant human TMED9 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-224 aa of BC001123

  Sequence: MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRH

• Full Name: transmembrane emp24 protein transport domain containing 9
• Calculated Molecular Weight: 235 aa, 27 kDa
• Observed Molecular Weight: 24-27 kDa
• GenBank Accession Number: BC001123
• Gene Symbol: TMED9
• Gene ID (NCBI): 54732
• RRID: AB_10858623
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BVK6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMED9 (also named as GMP25, GP25L2 or p25) is a member of the EMP24/GP25L family. TMED9 probably forms hetero-oligomeric complexes with TMED7 (p27), TMED2 (p24), and TMED10 (p23) (PMID: 10359607). Located in the endoplasmic reticulum and the Golgi, TMED9 appears to be involved in vesicular protein trafficking, mainly in the early secretory pathway (PMID: 9472029; 10359607).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Cell; Small Molecule Targets TMED9 and Promotes Lysosomal Degradation to Reverse Proteinopathy.; Authors - Moran Dvela-Levitt
human	WB	Cell; A Translocation Pathway for Vesicle-Mediated Unconventional Protein Secretion.; Authors - Min Zhang ; KO Validated
human	WB,CoIP	Cell Res; A new type of ERGIC-ERES membrane contact mediated by TMED9 and SEC12 is required for autophagosome biogenesis.; Authors - Shulin Li ; KD Validated
rat	WB	PLoS Biol; TMED9 coordinates the clearance of misfolded GPI-anchored proteins out of the ER and into the Golgi; Authors - Elsa Ronzier
human	WB	BMC Biol; ACBD3 modulates KDEL receptor interaction with PKA for its trafficking via tubulovesicular carrier.; Authors - Xihua Yue
	WB	Mol Biol Cell; The p24-family and COPII subunit SEC24C facilitate the clearance of alpha1-antitrypsin Z from the endoplasmic reticulum to lysosomes; Authors - Benjamin S Roberts

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Giulia (Verified Customer) (02-29-2024)

Specific antibody that works well in Western blot, both for cells and tissue lysates.

• Applications: Western Blot, Immunofluorescence