Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

TMED9 Polyclonal antibody

TMED9 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Glycoprotein 25L2, GMP25, GP25L2, p24 family protein alpha-2, p24alpha2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for TMED9 in ?

Tested Applications

Positive WB detected inA549 cells, pig liver tissue, HeLa cells, HepG2 cells, mouse liver tissue, rat liver tissue
Positive IP detected inHepG2 cells
Positive IHC detected inhuman liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells, HEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21620-1-AP targets TMED9 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13813

Product name: Recombinant human TMED9 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-224 aa of BC001123

Sequence: MAVELGVLLVRPRPGTGLGRVMRTLLLVLWLATRGSALYFHIGETEKKCFIEEIPDETMVIGNYRTQLYDKQREEYQPATPGLGMFVEVKDPEDKVILARQYGSEGRFTFTSHTPGEHQICLHSNSTKFSLFAGGMLRVHLDIQVGEHANDYAEIAAKDKLSELQLRVRQLVEQVEQIQKEQNYQRWREERFRQTSESTNQRVLWWSILQTLILVAIGVWQMRH

Predict reactive species
Full Name transmembrane emp24 protein transport domain containing 9
Calculated Molecular Weight 235 aa, 27 kDa
Observed Molecular Weight 25-27 kDa
GenBank Accession NumberBC001123
Gene Symbol TMED9
Gene ID (NCBI) 54732
RRIDAB_10858623
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BVK6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMED9 (also named as GMP25, GP25L2 or p25) is a member of the EMP24/GP25L family. TMED9 probably forms hetero-oligomeric complexes with TMED7 (p27), TMED2 (p24), and TMED10 (p23) (PMID: 10359607). Located in the endoplasmic reticulum and the Golgi, TMED9 appears to be involved in vesicular protein trafficking, mainly in the early secretory pathway (PMID: 9472029; 10359607).

Protocols

Product Specific Protocols
IF protocol for TMED9 antibody 21620-1-APDownload protocol
IHC protocol for TMED9 antibody 21620-1-APDownload protocol
IP protocol for TMED9 antibody 21620-1-APDownload protocol
WB protocol for TMED9 antibody 21620-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The antibody is anti-TMED9 (Cat# 21620-1-AP), with a total of 11 citations. Citations appear in journals including Cell, Cell Research, Advanced Science, Frontiers in Immunology, PLoS Biology, Journal of Cell Biology, BMC Biology, Annals of Translational Medicine, Molecular Biology of the Cell, and Bioengineered. Research fields span unconventional protein secretion, ER-to-Golgi trafficking, autophagosome biogenesis, lysosomal degradation, ER stress, and cancer biology (glioma, breast carcinoma).

SpeciesApplicationTitle
humanWB

Cell

A Translocation Pathway for Vesicle-Mediated Unconventional Protein Secretion.

Authors - Min Zhang
  • KO Validated
mouseIF

Cell

Small Molecule Targets TMED9 and Promotes Lysosomal Degradation to Reverse Proteinopathy.

Authors - Moran Dvela-Levitt
humanWB,CoIP

Cell Res

A new type of ERGIC-ERES membrane contact mediated by TMED9 and SEC12 is required for autophagosome biogenesis.

Authors - Shulin Li
  • KD Validated
humanWB

Adv Sci (Weinh)

TMED3 Complex Mediates ER Stress-Associated Secretion of CFTR, Pendrin, and SARS-CoV-2 Spike.

Authors - Hak Park

Front Immunol

TMED9: a potential therapeutic target and prognostic marker in glioma and its implications across pan-cancer contexts

Authors - Benyong Mi
ratWB

PLoS Biol

TMED9 coordinates the clearance of misfolded GPI-anchored proteins out of the ER and into the Golgi

Authors - Elsa Ronzier

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

Based on one review, this antibody is rated 4/5 and described as specific, performing well in Western blot for both cell and tissue lysates. The reviewer also used it for immunofluorescence. Overall, users report reliable specificity and good performance across multiple applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Giulia (Verified Customer) (02-29-2024)

Specific antibody that works well in Western blot, both for cells and tissue lysates.

  • Applications: Western Blot, Immunofluorescence
Loading...
||
New chat

Able™

正在加载,请稍候...