TMEM106B Monoclonal antibody, PBS Only

• 

  WB analysis using 60333-1-Ig (same clone as 60333-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 60333-1-Ig (TMEM106B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60333-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 60333-1-Ig (same clone as 60333-1-PBS)

  WB result of TMEM106B antibody (60333-1-Ig; 1:2000; room temperature for 1.5 hours) with wild-type and TMEM106B knockout HeLa cells. This data was developed using the same antibody clone with 60333-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 60333-1-Ig (same clone as 60333-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 60333-1-Ig (TMEM106B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60333-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 60333-1-Ig (same clone as 60333-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 60333-1-Ig (TMEM106B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60333-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 60333-1-Ig (same clone as 60333-1-PBS)

  IP result of anti-TMEM106B (IP:60333-1-Ig, 5ug; Detection:60333-1-Ig 1:500) with HeLa cells lysate 1720 ug. This data was developed using the same antibody clone with 60333-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TMEM106B Monoclonal Antibody for WB, IP, Indirect ELISA

Cat No. 60333-1-PBS

Clone No.5D1F8

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IP, Indirect ELISA

Synonyms

TMEM106B (1-46aa), 5D1F8, Transmembrane protein 106B

---

Product Information

60333-1-PBS targets TMEM106B in WB, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21448

  Product name: Recombinant human TMEM106B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-46 aa of BC033901

  Sequence: MGKSLSHLPLHSSKEDAYDGVTSENMRNGLVNSEVHNEDGRNGDVS

• Full Name: transmembrane protein 106B
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: ~40 kDa
• GenBank Accession Number: BC033901
• Gene Symbol: TMEM106B
• Gene ID (NCBI): 54664
• RRID: AB_2881442
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9NUM4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TMEM106B is a genetic risk factor for frontotemporal lobar degeneration with TDP-43 inclusions (FTLD-TDP). Amyotrophic lateral sclerosis (ALS), like FTLD-TDP, is characterized by pathological TDP-43 inclusions. TMEM106B expression in the brain may be linked to mechanisms of disease in FTLD-TDP and risk alleles confer genetic susceptibility by increasing gene expression.