Tested Applications
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue, mouse liver tissue |
| Positive FC (Intra) detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 5 publications below |
| IHC | See 2 publications below |
| IF | See 13 publications below |
| FC | See 1 publications below |
Product Information
27585-1-AP targets TMEM119 in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag26269 Product name: Recombinant human TMEM119 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 119-218 aa of NM_181724 Sequence: MRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQE Predict reactive species |
| Full Name | transmembrane protein 119 |
| Calculated Molecular Weight | 29 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | NM_181724 |
| Gene Symbol | TMEM119 |
| Gene ID (NCBI) | 338773 |
| RRID | AB_2880915 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q4V9L6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMEM119 immunohistochemistry might provide a useful tool for investigating the biology and pathology of human microglia(PMID: 26250788). Microglia can be detected clearly using Catalog#27585-1-AP.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TMEM119 antibody 27585-1-AP | Download protocol |
| IF protocol for TMEM119 antibody 27585-1-AP | Download protocol |
| FC protocol for TMEM119 antibody 27585-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Sci Adv Single-cell analysis of human basal cell carcinoma reveals novel regulators of tumor growth and the tumor microenvironment. | ||
Nat Commun P-selectin axis plays a key role in microglia immunophenotype and glioblastoma progression. | ||
Glia Transmembrane protein 119 is neither a specific nor a reliable marker for microglia. | ||
Pharmacol Res MSCs-extracellular vesicles attenuated neuroinflammation, synapse damage and microglial phagocytosis after hypoxia-ischemia injury by preventing osteopontin expression. | ||
Front Immunol Didymin Suppresses Microglia Pyroptosis and Neuroinflammation Through the Asc/Caspase-1/GSDMD Pathway Following Experimental Intracerebral Hemorrhage. | ||
Neurochem Res BMP7 Attenuates Neuroinflammation after Spinal Cord Injury by Suppressing the Microglia Activation and Inducing Microglial Polarization Via the STAT3 Pathway |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Marion (Verified Customer) (07-15-2025) | Immunohistofluorescence (PFA-fixed cryosections) image of TMEM119 stained murine brain. Blocking step : 10 % Donkey Serum + 1% BSA + 0.02% Triton as blocking agent for 2 hours at RT Primary antiboby incubation time : 1 night / 4°C Secondary antibody : AlexaFluor 568 (ab175470 ; Abcam) ; 1/200 This antibody does not seem to work under these conditions.
 |
FH Hannes (Verified Customer) (07-27-2020) | Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)IHC-P image of anti-TMEM119 (27585-1-AP) stained murine and human brain. The tissue was paraffin-embedded, formalin fixed. The tissue was then incubated with EnVision+ Single Reagents (HRP. Rabbit), undiluted for 1 hour at room temperature.
 |
