CoraLite® Plus 647-conjugated TMEM119 Polyclonal antibody

• 

  IF Staining of mouse liver using CL647-27585

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse liver tissue using CoraLite® Plus 647 TMEM119 antibody (CL647-27585) at dilution of 1:200. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  FC experiment of HEK-293 using CL647-27585

  1x10^6 HEK-293 cells were intracellularly stained with 0.4 ug CoraLite® Plus 647-conjugated TMEM119 Polyclonal antibody (CL647-27585)(red), or 0.4 ug CoraLite® Plus 647-conjugated Rabbit IgG control Rabbit PolyAb (CL647-30000) (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

TMEM119 Polyclonal Antibody for IF-P, FC (Intra)

Cat No. CL647-27585

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF-P, FC (Intra)

Synonyms

UNQ731/PRO1415, transmembrane protein 119, Osteoblast induction factor, OBIF

---

Tested Applications

• Positive IF-P detected in: mouse liver tissue
• Positive FC (Intra) detected in: HEK-293 cells

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-27585 targets TMEM119 in IF-P, FC (Intra) applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26269

  Product name: Recombinant human TMEM119 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 119-218 aa of NM_181724

  Sequence: MRQKQKASAYYPSSFPKKKYVDQSDRAGGPRAFSEVPDRAPDSRPEEALDSSRQLQADILAATQNLKSPTRAALGGGDGARMVEGRGAEEEEKGSQEGDQE

• Full Name: transmembrane protein 119
• Calculated Molecular Weight: 29 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: NM_181724
• Gene Symbol: TMEM119
• Gene ID (NCBI): 338773
• RRID: AB_3673571
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q4V9L6
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

TMEM119 immunohistochemistry might provide a useful tool for investigating the biology and pathology of human microglia(PMID: 26250788). Microglia can be detected clearly using Catalog#27585-1-AP. The predicted MW of TMEM119 is 29 kDa. Catalog#27585-1-AP recognizes 45-50 kDa band may due to glycosylation..