Tested Applications
Positive WB detected in | mouse cerebellum tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
24539-1-AP targets TMEM120B in WB, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21609 Product name: Recombinant human TMEM120B protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-83 aa of BC127768 Sequence: MSGQLERCEREWHELEGEFQELQETHRIYKQKLEELAALQTLCSSSISKQKKHLKDLKLTLQRCKRHASREEAELVQQMAANI Predict reactive species |
Full Name | transmembrane protein 120B |
Calculated Molecular Weight | 339 aa, 40 kDa |
Observed Molecular Weight | 50 kDa |
GenBank Accession Number | BC127768 |
Gene Symbol | TMEM120B |
Gene ID (NCBI) | 144404 |
RRID | AB_2879596 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | A0PK00 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMEM120B also named as transmembrane protein 120B is 339 amino acid multi-pass membrane protein, which belongs to the TMEM120 family and localizes in membrane. The function of TMEM120B is still non-known.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TMEM120B antibody 24539-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |