TMEM120B Polyclonal antibody

TMEM120B Polyclonal Antibody for WB, ELISA

Cat No. 24539-1-AP

Publications (1)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

TMEM120B, transmembrane protein 120B

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWB

WB analysis of mouse cerebellum using 24539-1-AP
mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 24539-1-AP (TMEM120B Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TMEM120B in ?

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in

mouse cerebellum tissue

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24539-1-AP targets TMEM120B in WB, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity	human, mouse
Cited Reactivity	mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag21609 Product name: Recombinant human TMEM120B protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-83 aa of BC127768 Sequence: MSGQLERCEREWHELEGEFQELQETHRIYKQKLEELAALQTLCSSSISKQKKHLKDLKLTLQRCKRHASREEAELVQQMAANI Predict reactive species
Full Name	transmembrane protein 120B
Calculated Molecular Weight	339 aa, 40 kDa
Observed Molecular Weight	50 kDa
GenBank Accession Number	BC127768
Gene Symbol	TMEM120B
Gene ID (NCBI)	144404
RRID	AB_2879596
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	A0PK00
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMEM120B also named as transmembrane protein 120B is 339 amino acid multi-pass membrane protein, which belongs to the TMEM120 family and localizes in membrane. The function of TMEM120B is still non-known.

Protocols

Product Specific Protocols
WB protocol for TMEM120B antibody 24539-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The TMEM120B Polyclonal antibody (Cat# 24539-1-AP) has a total of 1 citation. It appears in Nature Communications (IF 18.1), published in December 2025. The cited study, "TMEM120A maintains adipose tissue lipid homeostasis through ER CoA channeling," used this antibody for Western blot in mouse samples. The associated research field is adipose tissue lipid homeostasis and endoplasmic reticulum coenzyme A channeling.