Tested Applications
| Positive WB detected in | mouse cerebellum tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24539-1-AP targets TMEM120B in WB, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21609 Product name: Recombinant human TMEM120B protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 1-83 aa of BC127768 Sequence: MSGQLERCEREWHELEGEFQELQETHRIYKQKLEELAALQTLCSSSISKQKKHLKDLKLTLQRCKRHASREEAELVQQMAANI Predict reactive species |
| Full Name | transmembrane protein 120B |
| Calculated Molecular Weight | 339 aa, 40 kDa |
| Observed Molecular Weight | 50 kDa |
| GenBank Accession Number | BC127768 |
| Gene Symbol | TMEM120B |
| Gene ID (NCBI) | 144404 |
| RRID | AB_2879596 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | A0PK00 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
TMEM120B also named as transmembrane protein 120B is 339 amino acid multi-pass membrane protein, which belongs to the TMEM120 family and localizes in membrane. The function of TMEM120B is still non-known.
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for TMEM120B antibody 24539-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

