Tested Applications
Positive IP detected in | HeLa cells |
Positive IHC detected in | human stomach cancer tissue, human heart tissue, human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | NIH/3T3 cells |
Recommended dilution
Application | Dilution |
---|---|
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
Product Information
23142-1-AP targets TMEM127 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag19472 Product name: Recombinant human TMEM127 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 139-238 aa of BC039892 Sequence: QCATVIGFSYWASELILAQQQQHKKYHGSQVYVTFAVSFYLVAGAGGASILATAANLLRHYPTEEEEQALELLSEMEENEPYPAEYEVINQFQPPPAYTP Predict reactive species |
Full Name | transmembrane protein 127 |
Calculated Molecular Weight | 238 aa, 26 kDa |
Observed Molecular Weight | 26 kDa |
GenBank Accession Number | BC039892 |
Gene Symbol | TMEM127 |
Gene ID (NCBI) | 55654 |
RRID | AB_2879217 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen Affinity purified |
UNIPROT ID | O75204 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for TMEM127 antibody 23142-1-AP | Download protocol |
IF protocol for TMEM127 antibody 23142-1-AP | Download protocol |
IP protocol for TMEM127 antibody 23142-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Elife A cleaved METTL3 potentiates the METTL3-WTAP interaction and breast cancer progression | ||
Tissue Cell Exosomes from adipose-derived stem cells overexpressing microRNA-671-3p promote fat graft angiogenesis and adipogenic differentiation |