TMEM127 Polyclonal antibody, PBS Only

• 

  IP experiment of HeLa using 23142-1-AP (same clone as 23142-1-PBS)

  IP result of anti-TMEM127 (IP:23142-1-AP, 3ug; Detection:23142-1-AP 1:500) with HeLa cells lysate 3000ug. This data was developed using the same antibody clone with 23142-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 23142-1-AP (same clone as 23142-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 23142-1-AP (TMEM127 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23142-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human stomach cancer using 23142-1-AP (same clone as 23142-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 23142-1-AP (TMEM127 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 23142-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 23142-1-AP (same clone as 23142-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart slide using 23142-1-AP (TMEM127 Antibody) at dilution of 1:50. This data was developed using the same antibody clone with 23142-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 23142-1-AP (same clone as 23142-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer slide using 23142-1-AP (TMEM127 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 23142-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 23142-1-AP (same clone as 23142-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer slide using 23142-1-AP (TMEM127 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 23142-1-PBS in a different storage buffer formulation.

• 

  IF Staining of NIH/3T3 using 23142-1-AP (same clone as 23142-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using TMEM127 antibody (23142-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 23142-1-PBS in a different storage buffer formulation.

TMEM127 Polyclonal Antibody for IHC, IF/ICC, IP, Indirect ELISA

Cat No. 23142-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF/ICC, IP, Indirect ELISA

Synonyms

Transmembrane protein 127

---

Product Information

23142-1-PBS targets TMEM127 in IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19472

  Product name: Recombinant human TMEM127 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 139-238 aa of BC039892

  Sequence: QCATVIGFSYWASELILAQQQQHKKYHGSQVYVTFAVSFYLVAGAGGASILATAANLLRHYPTEEEEQALELLSEMEENEPYPAEYEVINQFQPPPAYTP

• Full Name: transmembrane protein 127
• Calculated Molecular Weight: 238 aa, 26 kDa
• Observed Molecular Weight: 26 kDa
• GenBank Accession Number: BC039892
• Gene Symbol: TMEM127
• Gene ID (NCBI): 55654
• RRID: AB_2879217
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: O75204
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.