Tested Applications
| Positive IF/ICC detected in | hTERT-RPE1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
26642-1-AP targets TMEM138 in IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24487 Product name: Recombinant human TMEM138 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 101-162 aa of BC005201 Sequence: NLRWKNSNSFIWTDGLQMLFVFQRLAAVLYCYFYKRTAVRLGDPHFYQDSLWLRKEFMQVRR Predict reactive species |
| Full Name | transmembrane protein 138 |
| Calculated Molecular Weight | 162 aa, 19 kDa |
| GenBank Accession Number | BC005201 |
| Gene Symbol | TMEM138 |
| Gene ID (NCBI) | 51524 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NPI0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for TMEM138 antibody 26642-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |

