TMEM151B Polyclonal antibody, PBS Only

• 

  WB analysis using 31682-1-AP (same clone as 31682-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31682-1-AP (TMEM151B antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31682-1-PBS in a different storage buffer formulation.

TMEM151B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31682-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

bA444E17.5, C6orf137, TMEM193, transmembrane protein 151B, Transmembrane protein 193

---

Product Information

31682-1-PBS targets TMEM151B in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34641

  Product name: Recombinant human TMEM151B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 390-530 aa of NM_001137560

  Sequence: AVLMDLAGLGTRCGGAGGGYAPSCRYGGVGGPGAAGVAPYRRSCEHCQRAVSSSSIFSRSALSICASPRAGPGPGGGAGCGGSRFSLGRLYGSRRSCLWRSRSGSVNEASCPTEQTRLSSQASMGDDEDDDEEEAGPPPPY

• Full Name: transmembrane protein 151B
• Calculated Molecular Weight: 62 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: NM_001137560
• Gene Symbol: TMEM151B
• Gene ID (NCBI): 441151
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q8IW70
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

TMEM151B (Transmembrane protein 151B) may be an integral component of the membrane.