TMEM154 Polyclonal antibody

• 

  IHC staining of human kidney using 24812-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24812-1-AP (TMEM154 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human kidney using 24812-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24812-1-AP (TMEM154 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human breast cancer using 24812-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24812-1-AP (TMEM154 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human breast cancer using 24812-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24812-1-AP (TMEM154 Antibody) at dilution of 1:50 (under 40x lens).

TMEM154 Polyclonal Antibody for IHC, ELISA

Cat No. 24812-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, ELISA

Synonyms

TMEM154, transmembrane protein 154

---

Tested Applications

• Positive IHC detected in: human kidney tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

24812-1-AP targets TMEM154 in IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20054

  Product name: Recombinant human TMEM154 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 91-183 aa of BC060775

  Sequence: LLFVVFLATYYKRKRTKQEPSSQGSQSALQTYELGSENVKVPIFEEDTPSVMEIEMEELDKWMNSMNRNADFECLPTLKEEKESNHNPSDSES

• Full Name: transmembrane protein 154
• Calculated Molecular Weight: 183 aa, 21 kDa
• GenBank Accession Number: BC060775
• Gene Symbol: TMEM154
• Gene ID (NCBI): 201799
• RRID: AB_2879738
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6P9G4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.