TMEM154 Polyclonal antibody, PBS Only

• 

  IHC staining of human kidney using 24812-1-AP (same clone as 24812-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24812-1-AP (TMEM154 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 24812-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 24812-1-AP (same clone as 24812-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 24812-1-AP (TMEM154 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 24812-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 24812-1-AP (same clone as 24812-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24812-1-AP (TMEM154 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 24812-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 24812-1-AP (same clone as 24812-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24812-1-AP (TMEM154 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 24812-1-PBS in a different storage buffer formulation.

TMEM154 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 24812-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

24812-1-PBS targets TMEM154 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20054

  Product name: Recombinant human TMEM154 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 91-183 aa of BC060775

  Sequence: LLFVVFLATYYKRKRTKQEPSSQGSQSALQTYELGSENVKVPIFEEDTPSVMEIEMEELDKWMNSMNRNADFECLPTLKEEKESNHNPSDSES

• Full Name: transmembrane protein 154
• Calculated Molecular Weight: 183 aa, 21 kDa
• GenBank Accession Number: BC060775
• Gene Symbol: TMEM154
• Gene ID (NCBI): 201799
• RRID: AB_2879738
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6P9G4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.