Home
Products
Primary Antibodies
Recombinant Antibodies
TMEM173/STING Recombinant monoclonal antibody, PBS Only (80165-1-PBS)

TMEM173/STING Recombinant monoclonal antibody, PBS Only

Name: TMEM173/STING Recombinant monoclonal antibody, PBS Only, 100ug
Brand: Proteintech
SKU: 80165-1-PBS-100UG

TMEM173/STING Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, IF-P, IF-Fro, IP, Indirect ELISA

Cat No. 80165-1-PBS

Clone No. 7K7

Publications (1)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, IF-Fro, IP, Indirect ELISA

Synonyms

STING, Endoplasmic reticulum interferon stimulator, ERIS, MITA, MPYS

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHCIF-PIF-FroIF/ICCAffinity

WB analysis using 80165-1-RR (same clone as 80165-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 80165-1-RR (TMEM173/STING antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 80165-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 80165-1-RR (same clone as 80165-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 80165-1-RR (TMEM173/STING antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 80165-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of HeLa using 80165-1-RR (same clone as 80165-1-PBS)
IP result of anti-TMEM173/STING (IP: 80165-1-RR, 4ug; Detection: 80165-1-RR 1:8000) with HeLa cells lysate 1800 ug. This data was developed using the same antibody clone with 80165-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 80165-1-RR (same clone as 80165-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 80165-1-RR (TMEM173/STING antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80165-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 80165-1-RR (same clone as 80165-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 80165-1-RR (TMEM173/STING antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80165-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon using 80165-1-RR (same clone as 80165-1-PBS)
Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 80165-1-RR (TMEM173/STING antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80165-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human tonsillitis using 80165-1-RR (same clone as 80165-1-PBS)
Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 80165-1-RR (TMEM173/STING antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80165-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of mouse liver using 80165-1-RR (same clone as 80165-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 80165-1-RR (TMEM173/STING antibody) at dilution of 1:4000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80165-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 80165-1-RR (same clone as 80165-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 80165-1-RR (TMEM173/STING antibody) at dilution of 1:4000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80165-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 80165-1-RR (same clone as 80165-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 80165-1-RR (TMEM173/STING antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80165-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 80165-1-RR (same clone as 80165-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 80165-1-RR (TMEM173/STING antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 80165-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of human tonsillitis using 80165-1-RR (same clone as 80165-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed human tonsillitis tissue using TMEM173/STING antibody (80165-1-RR, Clone: 7K7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 80165-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of mouse cerebellum using 80165-1-RR (same clone as 80165-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed frozen OCT-embedded mouse cerebellum tissue using TMEM173/STING antibody (80165-1-RR, Clone: 7K7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 80165-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of THP-1 using 80165-1-RR (same clone as 80165-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using TMEM173/STING antibody (80165-1-RR, Clone: 7K7 ) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 80165-1-PBS in a different storage buffer formulation.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
Affinity and Kinetic Characterization of 80165-1-RR
Biolayer interferometry (BLl) kinetic assays of 80165-1-RR against Human TMEM173/STING were performed. The affinity constant is 0.776 nM.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for TMEM173/STING in ?

Overview

Tested Applications
Product Information
Publications (1)

Print datasheet

MSDS SDS

Product Information

80165-1-PBS targets TMEM173/STING in WB, IHC, IF/ICC, IF-P, IF-Fro, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Recombinant
Type	Antibody
Immunogen	CatNo: Ag13921 Product name: Recombinant human TMEM173 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 174-379 aa of BC047779 Sequence: ELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS Predict reactive species
Full Name	transmembrane protein 173
Calculated Molecular Weight	379 aa, 42 kDa
Observed Molecular Weight	37 kDa
GenBank Accession Number	BC047779
Gene Symbol	STING
Gene ID (NCBI)	340061
RRID	AB_2918870
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	Q86WV6
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Stimulator of interferon genes (STING, also known as ERIS, MITA and MPYS, and encoded by TMEM173) is a transmembrane adaptor protein that facilitates innate immune signaling (PMID: 18724357). STING is widely expressed in various cell types such as endothelial cells, epithelial cells, T cells, macrophages, and dendritic cells (PMID: 26603901). It is predominantly located in the endoplasmic reticulum (ER). STING functions as a sensor of cytosolic DNA and promotes the production of type I interferons and pro-inflammatory cytokines.

Publications

What published studies show

The TMEM173/STING Recombinant monoclonal antibody (7K7), catalog number 80165-1-PBS, has a total citation count of 13. Citations appear in journals including FASEB Journal. The associated research fields include innate immune signaling, vascular calcification, and inflammatory pathway regulation (e.g., p-STAT1/NLRP3 signaling). The antibody has been validated in applications such as WB, IHC, IF, and CoIP, with cited reactivity in human and mouse species.