Tested Applications
Positive WB detected in | mouse liver tissue |
Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 2 publications below |
IF | See 1 publications below |
Product Information
24799-1-AP targets TMEM179 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20502 Product name: Recombinant human TMEM179 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 115-197 aa of BC148844 Sequence: AFVVFLVFIASTIVSVGFTMWCDTITEKGTVPHSCEELQDIDLELGVDNSAFYDQFAIAQVGGSGQEGRLAMLGGGHLLLDIC Predict reactive species |
Full Name | transmembrane protein 179 |
Calculated Molecular Weight | 233 aa, 26 kDa |
Observed Molecular Weight | 32 kDa |
GenBank Accession Number | BC148844 |
Gene Symbol | TMEM179 |
Gene ID (NCBI) | 388021 |
RRID | AB_2879732 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q6ZVK1 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for TMEM179 antibody 24799-1-AP | Download protocol |
IHC protocol for TMEM179 antibody 24799-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Ecotoxicol Environ Saf NAC antagonizes arsenic-induced neurotoxicity through TMEM179 by inhibiting oxidative stress in Oli-neu cells.
| ||
PLoS One Construction of ceRNA network to identify the lncRNA and mRNA related to non-small cell lung cancer. |