Tested Applications
| Positive WB detected in | mouse liver tissue |
| Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24799-1-AP targets TMEM179 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20502 Product name: Recombinant human TMEM179 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 115-197 aa of BC148844 Sequence: AFVVFLVFIASTIVSVGFTMWCDTITEKGTVPHSCEELQDIDLELGVDNSAFYDQFAIAQVGGSGQEGRLAMLGGGHLLLDIC Predict reactive species |
| Full Name | transmembrane protein 179 |
| Calculated Molecular Weight | 233 aa, 26 kDa |
| Observed Molecular Weight | 32 kDa |
| GenBank Accession Number | BC148844 |
| Gene Symbol | TMEM179 |
| Gene ID (NCBI) | 388021 |
| RRID | AB_2879732 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6ZVK1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TMEM179 antibody 24799-1-AP | Download protocol |
| WB protocol for TMEM179 antibody 24799-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Ecotoxicol Environ Saf NAC antagonizes arsenic-induced neurotoxicity through TMEM179 by inhibiting oxidative stress in Oli-neu cells.
| ||
PLoS One Construction of ceRNA network to identify the lncRNA and mRNA related to non-small cell lung cancer. |









