• Featured Product
  • KD/KO Validated

TMEM179 Polyclonal antibody

TMEM179 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 24799-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF, IHC, ELISA

C14orf90, TMEM179, TMEM179A, transmembrane protein 179, Transmembrane protein 179A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24799-1-AP targets TMEM179 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20502

Product name: Recombinant human TMEM179 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 115-197 aa of BC148844

Sequence: AFVVFLVFIASTIVSVGFTMWCDTITEKGTVPHSCEELQDIDLELGVDNSAFYDQFAIAQVGGSGQEGRLAMLGGGHLLLDIC

Predict reactive species
Full Name transmembrane protein 179
Calculated Molecular Weight 233 aa, 26 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC148844
Gene Symbol TMEM179
Gene ID (NCBI) 388021
RRIDAB_2879732
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6ZVK1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for TMEM179 antibody 24799-1-APDownload protocol
WB protocol for TMEM179 antibody 24799-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB,IF

Ecotoxicol Environ Saf

NAC antagonizes arsenic-induced neurotoxicity through TMEM179 by inhibiting oxidative stress in Oli-neu cells.

Authors - Zhixin He
  • KD Validated
humanWB

PLoS One

Construction of ceRNA network to identify the lncRNA and mRNA related to non-small cell lung cancer.

Authors - Kui Xiao
Loading...
||
New chat Able
正在加载,请稍候...