TMEM179 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse liver using 24799-1-AP (same clone as 24799-1-PBS)

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 24799-1-AP (TMEM179 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24799-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 24799-1-AP (same clone as 24799-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24799-1-AP (TMEM179 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24799-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 24799-1-AP (same clone as 24799-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24799-1-AP (TMEM179 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24799-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 24799-1-AP (same clone as 24799-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24799-1-AP (TMEM179 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24799-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 24799-1-AP (same clone as 24799-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 24799-1-AP (TMEM179 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24799-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

TMEM179 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 24799-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

24799-1-PBS targets TMEM179 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20502

  Product name: Recombinant human TMEM179 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 115-197 aa of BC148844

  Sequence: AFVVFLVFIASTIVSVGFTMWCDTITEKGTVPHSCEELQDIDLELGVDNSAFYDQFAIAQVGGSGQEGRLAMLGGGHLLLDIC

• Full Name: transmembrane protein 179
• Calculated Molecular Weight: 233 aa, 26 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC148844
• Gene Symbol: TMEM179
• Gene ID (NCBI): 388021
• RRID: AB_2879732
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6ZVK1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.