Tested Applications
| Positive IHC detected in | mouse brain tissue, mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28031-1-AP targets TMEM184B in IHC, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27704 Product name: Recombinant human TMEM184B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 318-407 aa of BC015489 Sequence: VYADKRLDAQGRCAPMKSISSSLKETMNPHDIVQDAIHNFSPAYQQYTQQSTLEPGPTWRGGAHGLSRSHSLSGARDNEKTLLLSSDDEF Predict reactive species |
| Full Name | transmembrane protein 184B |
| GenBank Accession Number | BC015489 |
| Gene Symbol | TMEM184B |
| Gene ID (NCBI) | 25829 |
| RRID | AB_3086023 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y519 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Transmembrane protein 184B (TMEM184B) is a seven-pass transmembrane protein highly expressed in the nervous system and is thought to play a role in neuronal excitability, synaptic structure, and expression of key developmental and adult pathways involved in neuronal differentiation (PMID: 27122027; 37730546). TMEM184B may activate the MAP kinase signaling pathway (PMID: 12761501). TMEM184B has also been reported to be necessary for interleukin-31-induced itch, promoting adult somatosensation through developmental Wnt signaling and promotion of proper pruriceptive gene expression (PMID: 34629389).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for TMEM184B antibody 28031-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







