TMEM208 Polyclonal antibody

• 

  WB analysis of mouse brain using 23882-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 23882-1-AP (TMEM208 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach using 23882-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 23882-1-AP (TMEM208 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human stomach using 23882-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 23882-1-AP (TMEM208 Antibody) at dilution of 1:200 (under 40x lens).

• 

  IHC staining of mouse stomach using 23882-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 23882-1-AP (TMEM208 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

TMEM208 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 23882-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

HSND2, HSPC171, SND2, Transmembrane protein 208

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IHC detected in: human stomach tissue, mouse stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 4 publications below
• IHC: See 1 publications below

Product Information

23882-1-AP targets TMEM208 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20845

  Product name: Recombinant human TMEM208 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-173 aa of BC003080

  Sequence: MAPKGKVGTRGKKQIFEENRETLKFYLRIILGANAIYCLVTLVFFYSSASFWAWLALGFSLAVYGASYHSMSSMARAAFSEDGALMDGGMDLNMEQGMAEHLKDVILLTAIVQVLSCFSLYVWSFWLLAPGRALYLLWVNVLGPWFTADSGTPAPEHNEKRQRRQERRQMKRL

• Full Name: transmembrane protein 208
• Calculated Molecular Weight: 173 aa, 20 kDa
• Observed Molecular Weight: 19-29 kDa
• GenBank Accession Number: BC003080
• Gene Symbol: TMEM208
• Gene ID (NCBI): 29100
• RRID: AB_2879349
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen Affinity purified
• UNIPROT ID: Q9BTX3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transmembrane protein 208 (TMEM208) can regulate both autophagy and ER stress. When overexpressed, TMEM208 impaired autophagy as characterized by the decrease of the accumulation of LC3-II, decreased degradation of autophagic substrates, and reduced expression of critical effectors and vital molecules of the ER stress and autophagy processes. (PMID: 23691174)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Biol Chem; Transmembrane insertases and N-glycosylation critically determine synthesis, trafficking and activity of the nonselective cation channel TRPC6.; Authors - Brianna E Talbot
human	WB,IHC	J Mammary Gland Biol Neoplasia; Transcription Impairment of TMEM208 by ZBTB14 Suppresses Breast cancer Radiotherapy Resistance; Authors - Yan Li
human	WB	Nat Cancer; Targeting LIPA independent of its lipase activity is a therapeutic strategy in solid tumors via induction of endoplasmic reticulum stress; Authors - Xihui Liu
human	WB	Cell Rep; Sequential genome-wide CRISPR-Cas9 screens identify genes regulating cell-surface expression of tetraspanins; Authors - Jicheng Yang ; KO Validated