• Featured Product
  • KD/KO Validated

TMEM25 Polyclonal antibody, PBS Only

TMEM25 Polyclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 24361-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

24361-1-PBS targets TMEM25 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19964

Product name: Recombinant human TMEM25 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 28-323 aa of BC051841

Sequence: LEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAPGPSRHPSLISSDSNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSRGFIRLPVLGYIYRVSSVSSDEIWL

Predict reactive species
Full Name transmembrane protein 25
Calculated Molecular Weight 366 aa, 39 kDa
Observed Molecular Weight 40 kDa
GenBank Accession NumberBC051841
Gene Symbol TMEM25
Gene ID (NCBI) 84866
RRIDAB_2879507
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ86YD3
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

TMEM25 is a novel member of the immunoglobulin superfamily. BC042896 and AY358919 cDNAs are derived from human TMEM25 gene. TMEM25 isoform 1 (BC042896), consisting of exons 1-9, encodes a 366-aa transmembrane protein. TMEM25 isoform 2 (AY358919), consisting of exons 1-4 and 6-9, encodes a 322-aa secreted protein (PMID:15254712). Human TMEM25 gene are found to encode transmembrane-type as well as secreted-type proteins due to alternative splicing of exon-skipping type. TMEM25 mRNA is expressed in brain, including cerebellar cortex and hippocampus, as well as in neuroblastoma, brain tumors, and gastric cancer. TMEM25 is a target of pharmacogenomics in the field of oncology and regenerative medicine. TMEM25 mRNAs may be useful members of a panel of favorable prognostic and predictive markers for breast cancer( PMID:19776672).

Loading...
||
New chat Able
正在加载,请稍候...