TMEM25 Polyclonal antibody

• 

  WB analysis using 24361-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24361-1-AP (TMEM25 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver using 24361-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 24361-1-AP (TMEM25 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

TMEM25 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 24361-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, IHC, CoIP, ELISA

Synonyms

TMEM25, transmembrane protein 25

---

Tested Applications

• Positive WB detected in: mouse liver tissue, rat liver tissue
• Positive IHC detected in: human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IF: See 1 publications below
• CoIP: See 1 publications below

Product Information

24361-1-AP targets TMEM25 in WB, IF, IHC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19964

  Product name: Recombinant human TMEM25 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 28-323 aa of BC051841

  Sequence: LEPQIDGQTWAERALRENERHAFTCRVAGGPGTPRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPRSGRSANASVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFLVLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAPGPSRHPSLISSDSNNLKLNNVRLPRENMSLPSNLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSRGFIRLPVLGYIYRVSSVSSDEIWL

• Full Name: transmembrane protein 25
• Calculated Molecular Weight: 366 aa, 39 kDa
• Observed Molecular Weight: 40 kDa
• GenBank Accession Number: BC051841
• Gene Symbol: TMEM25
• Gene ID (NCBI): 84866
• RRID: AB_2879507
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86YD3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TMEM25 is a novel member of the immunoglobulin superfamily. BC042896 and AY358919 cDNAs are derived from human TMEM25 gene. TMEM25 isoform 1 (BC042896), consisting of exons 1-9, encodes a 366-aa transmembrane protein. TMEM25 isoform 2 (AY358919), consisting of exons 1-4 and 6-9, encodes a 322-aa secreted protein (PMID:15254712). Human TMEM25 gene are found to encode transmembrane-type as well as secreted-type proteins due to alternative splicing of exon-skipping type. TMEM25 mRNA is expressed in brain, including cerebellar cortex and hippocampus, as well as in neuroblastoma, brain tumors, and gastric cancer. TMEM25 is a target of pharmacogenomics in the field of oncology and regenerative medicine. TMEM25 mRNAs may be useful members of a panel of favorable prognostic and predictive markers for breast cancer( PMID:19776672).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IF,CoIP	J Clin Invest; TMEM25 modulates neuronal excitability and NMDA receptor subunit NR2B degradation.; Authors - Haiqing Zhang ; KD Validated