Product Information
84510-3-PBS targets TMEM41B as part of a matched antibody pair:
MP01380-1: 84510-3-PBS capture and 84510-1-PBS detection (validated in Cytometric bead array)
MP01380-2: 84510-3-PBS capture and 84510-2-PBS detection (validated in Cytometric bead array)
Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.
This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag30810 Product name: Recombinant human TMEM41B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-109 aa of BC035034 Sequence: MAKGRVAERSQLGAHHTTPVGDGAAGTRGLAAPGSRDHQKEKSWVEAGSARMSLLILVSIFLSAAFVMFLVYKNFPQLSEEERVNMKVPRDMDDAKALGKVLSKYKDTF Predict reactive species |
Full Name | transmembrane protein 41B |
Calculated Molecular Weight | 32 kDa |
GenBank Accession Number | BC035034 |
Gene Symbol | TMEM41B |
Gene ID (NCBI) | 440026 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | Q5BJD5 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |